| Protein: 328793616 XP_001122762.2 PREDICTED: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 27.8 | 18.7 | 53.5 | 0.51962614 | 0.34953272 |
| Brain | 43.2 | 56.8 | 0.7605634 | ||
| Crop | 33.8 | 66.2 | 0.51057404 | ||
| Eye | |||||
| Intestine | 34.7 | 29.2 | 36.1 | 0.96121883 | 0.8088643 |
| Leg, front | 23.3 | 35.1 | 41.6 | 0.56009614 | 0.84375 |
| Leg, middle | 41.4 | 29.7 | 28.9 | 1.432526 | 1.0276817 |
| Leg, rear | 12.5 | 17.6* | 69.9 | 0.1788269 | 0.25178826 |
| Mandibular gland | 35.6 | 64.4 | 0.55279505 | ||
| Rectum | |||||
| Salivary gland, cerebral | 48.9 | 13.7 | 37.4 | 1.3074867 | 0.36631015 |
| Salivary gland, thoracic | 34.9 | 40.3 | 24.8 | 1.407258 | 1.625 |
| Sternite | 31.6 | 30.5 | 37.9 | 0.8337731 | 0.80474937 |
| Tergite | 36.7 | 25.4 | 37.9 | 0.9683377 | 0.6701847 |
| Ventriculus | |||||
| Thoracic muscle | 51.6 | 48.4 | 1.0661157 | ||
| Fat body | 68.8 | 31.2 | 2.2051282 | ||
| Malpighian tubules | 53* | 25.3 | 21.7 | 2.4423964 | 1.1658986 |
| Nerve chord | 85.6* | 5.7 | 8.7 | 9.839081 | 0.6551724 |
| Poison sac | |||||
| Sting | |||||
| Heart | 50.9 | 19 | 30.1 | 1.6910299 | 0.6312292 |
| Hypopharyngeal gland | |||||
| Galea | 48 | 20.8 | 31.2 | 1.5384616 | 0.6666667 |
| Glossa | 42.9 | 27.5 | 29.6 | 1.4493244 | 0.9290541 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.8 | 28.2 | 39.8 | 1.0251256 | 0.7085427 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKKSYLRIVLYLKMAAIKFGPQLKELRILLCQTSKSSQGVRDFIEKQYVPLKRSNPQFPI LIRECSLIEPILYARYEFGVERSFSLQNLQSEEILQRIREIAISKSK |
 Top
| |