| Protein: 48129806 XP_396656.1 PREDICTED: Na(+)/H(+) exchange regulatory cofactor NHE-RF1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 32.1 | 40 | 27.9 | 1.1505376 | 1.4336917 |
| Scape | 30.6 | 36.8 | 32.6 | 0.9386503 | 1.1288344 |
| Brain | |||||
| Crop | 42.6 | 57.4 | 0.74216026 | ||
| Eye | |||||
| Intestine | 39.7 | 39.1 | 21.2 | 1.8726416 | 1.8443396 |
| Leg, front | 32.4 | 34.6 | 33 | 0.9818182 | 1.0484848 |
| Leg, middle | 38.8 | 35.7 | 25.6 | 1.515625 | 1.3945312 |
| Leg, rear | 36.3 | 37.4 | 26.3 | 1.3802282 | 1.4220532 |
| Mandibular gland | 7.9 | 61.3 | 30.8 | 0.2564935 | 1.9902598 |
| Rectum | |||||
| Salivary gland, cerebral | 82 | 18 | 4.5555553 | ||
| Salivary gland, thoracic | 72.3* | 2.9* | 24.8 | 2.9153225 | 0.11693548 |
| Sternite | 23.5 | 49.9 | 26.6 | 0.8834587 | 1.8759398 |
| Tergite | |||||
| Ventriculus | 76.6 | 23.4 | 3.2735043 | ||
| Thoracic muscle | |||||
| Fat body | 60.4 | 27.8 | 11.9 | 5.07563 | 2.3361344 |
| Malpighian tubules | 30.4 | 45 | 24.6 | 1.2357724 | 1.8292683 |
| Nerve chord | 36.9 | 43.9 | 19.3 | 1.9119171 | 2.2746115 |
| Poison sac | |||||
| Sting | 52.4 | 47.6 | 1.1008403 | ||
| Heart | 40.5 | 34.8 | 24.6 | 1.6463414 | 1.4146341 |
| Hypopharyngeal gland | 18 | 82 | 0.2195122 | ||
| Galea | 27.1 | 34.6 | 38.2 | 0.7094241 | 0.90575916 |
| Glossa | 44.3 | 29.6 | 26.1 | 1.697318 | 1.1340996 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.7 | 39.1 | 31.1 | 1.2765273 | 1.2572347 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSLKGDKIPCARLCHIVKWDDFDGYGFNLHAEKGKNGQFIGKVDDGSPSQAAGLRQGDR IIEVNEINIANETHKQVVERIKAFPNETKLLVVDQEADEYFRANNIVIKGTMANVKVIKT PEKNPNSSEQEELNGSNASTDETAQKSSGSNDTLHSESSTVSASATRTSTRSENDNENES EREETGQENGNSIKNDTTTTMAHVHGTGNGNVAGNNESRQGLNLKMSAKELRAQLALRKK YDPKKESIGFKDKFDIVQKL |
 Top
| |