| Protein: 66526470 XP_624102.1 PREDICTED: electron transfer flavoprotein subunit alpha mitochondrial-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 20.5 | 39.9 | 39.7 | 0.5163728 | 1.0050378 |
| Scape | 26.6 | 42 | 31.3 | 0.8498403 | 1.341853 |
| Brain | 19.9 | 63.6* | 16.5 | 1.2060606 | 3.8545454 |
| Crop | 16.6 | 49 | 34.3 | 0.483965 | 1.4285715 |
| Eye | |||||
| Intestine | 33.6 | 29.9 | 36.5 | 0.92054796 | 0.8191781 |
| Leg, front | 32.4 | 40.4 | 27.2 | 1.1911764 | 1.4852941 |
| Leg, middle | 32 | 41.8 | 26.3 | 1.21673 | 1.5893536 |
| Leg, rear | 56.2 | 28.9 | 14.8 | 3.7972972 | 1.9527028 |
| Mandibular gland | 40.2 | 59.8 | 0.6722408 | ||
| Rectum | 15.9 | 49.9 | 34.2 | 0.4649123 | 1.4590644 |
| Salivary gland, cerebral | 89.5* | 8.1 | 2.4 | 37.291668 | 3.375 |
| Salivary gland, thoracic | 13* | 54.2 | 32.9 | 0.39513677 | 1.6474165 |
| Sternite | 24.3 | 62.2 | 13.5 | 1.8 | 4.6074076 |
| Tergite | 15.8 | 60 | 24.2 | 0.6528926 | 2.479339 |
| Ventriculus | 46.3 | 53.7 | 0.8621974 | ||
| Thoracic muscle | 4.1 | 79 | 16.9 | 0.24260356 | 4.6745563 |
| Fat body | 11.8 | 56.3 | 31.9 | 0.36990595 | 1.7648903 |
| Malpighian tubules | 29.6 | 37.9 | 32.5 | 0.9107692 | 1.1661538 |
| Nerve chord | 20 | 58.5 | 21.5 | 0.9302326 | 2.7209303 |
| Poison sac | |||||
| Sting | 56.8 | 43.2 | 1.3148148 | ||
| Heart | 16.7 | 48.7 | 34.6 | 0.48265895 | 1.4075145 |
| Hypopharyngeal gland | 78.5 | 21.5 | 3.6511629 | ||
| Galea | 28.3 | 37.7 | 34 | 0.83235294 | 1.1088235 |
| Glossa | 48.6 | 51.4 | 0.9455253 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.2 | 48.7 | 30.6 | 0.92156863 | 1.5915033 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFATYFRTFRIANKYGLLARYESTLVIAEHNNESLLPITCNTLSAAKKIGGDITVLVAGS KCDAVAQSVSKANGVSKVLIADSDAFKGFFPEALTPLILAIQNEYKFTHILSGATAFGKA LLPRIAAKLDVSPVSDIIDIKSSDTFIRTIYAGNAIQTLKCKDNVKIVTIRGTSFEATPL EGGNAKCEAAPAGDYKSELIEFIKQDLSKSDRPELTSAKVVISGGRGMKSGENFKLLYTL ADKLNAAVGASRAAVDAGFVPNDLQVGQTGKIVAPNLYIAVGISGAIQHLAGMKDSKTIV AINKDPEAPIFQVADYGLVADLFKAVPELTEKL |
 Top
| |