![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328782279 XP_003250115.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 1-like partial |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 17.8 | 82.2 | 0.21654502 | ||
| Brain | |||||
| Crop | 34.7 | 65.3 | 0.5313936 | ||
| Eye | |||||
| Intestine | 24.4 | 47.3 | 28.3 | 0.86219084 | 1.6713781 |
| Leg, front | 43.7 | 56.3 | 0.7761989 | ||
| Leg, middle | 36.1 | 21.6 | 42.2 | 0.8554502 | 0.51184833 |
| Leg, rear | 45.9 | 54.1 | 0.84842885 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 70.1 | 29.9 | 2.3444817 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 36.2 | 63.8 | 0.56739813 | ||
| Malpighian tubules | 32.9 | 32.3 | 34.8 | 0.9454023 | 0.9281609 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 6.5 | 53.3 | 40.1 | 0.16209476 | 1.329177 |
| Hypopharyngeal gland | 34.4 | 65.6 | 0.5243902 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.6 | 38.7 | 51.1 | 0.6183953 | 0.7573385 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKINMNITSAAGIISLLEEPMPELKVFALKKLDMIVDEFWPEISEAIEKIEILHEDKSFP QHDLAALVASKVYYHLGSFEDSLTYALGAGELFDVNARNEYVDTTIAKCIDYYTQQRVLE AEGKLPPTSKGIDPRLEGIVNRMFQRCLDDNQYRQALGLALETRRMDIFEAAIMQSDDVS GMLSYAFQVVMSLIQNRGFRNTVLRCLVSLYRNLGTPDYVNMCQCLIFLDDPLAVAELLD RLSKGSQDCVLMAYQIAFDLYESATQQFLGRVLQALRATAPIPGALMVKPIVKPAAKVST EATVSSESTPVMETESTTPVSEEKSQRNALSSILGGEISIDLHLQFLIRSNHTDMLILKN TKDTIRVSICHTATVIANAYMHSGTTSDQFLRDNLEWLARATNWAKLTATASLGVIHRGH EQEALALMQSYLPRDSGAGAGYSEGGGLYALGLIHANHGAAITDYLLGQLKDAQNEYAQE TQHEKILRGLAVGIAFTMYGRLEEADPLVASLCADKDPILRRSGMYTLAMAYCGTGNNQA IRKLLHVAVSDVNDDVRRAAVTGLGFLLF |
|
| |