| Protein: 110762023 XP_396711.3 PREDICTED: GTP-binding protein CG1354-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 43.9 | 56.1 | 0.7825312 | ||
| Scape | 38.5 | 27.7 | 33.8 | 1.1390532 | 0.8195266 |
| Brain | 41.3 | 58.7 | 0.7035775 | ||
| Crop | 45.1 | 54.9 | 0.8214936 | ||
| Eye | |||||
| Intestine | 15.4* | 84.6 | 0.18203309 | ||
| Leg, front | 19.3 | 50.5 | 30.2 | 0.63907284 | 1.6721854 |
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 11.3 | 88.7 | 0.12739572 | ||
| Salivary gland, thoracic | 32.5 | 29.2 | 38.3 | 0.84856397 | 0.7624021 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 73.2 | 26.8 | 2.7313433 | ||
| Malpighian tubules | 57.8 | 42.2 | 1.3696682 | ||
| Nerve chord | 34.2 | 40 | 25.8 | 1.3255814 | 1.5503876 |
| Poison sac | |||||
| Sting | |||||
| Heart | 37.7 | 38.3 | 24 | 1.5708333 | 1.5958333 |
| Hypopharyngeal gland | 30.6 | 69.4 | 0.4409222 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.2 | 34.9 | 48.7 | 0.8049281 | 0.7166324 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAPKKIEEPERKPLIGRVGTNLKVGIVGIPNVGKSTFFNVLTKSQAAAENFPFCTIDPNE SRVPVPDARFDYLCDYFKPASKVPAFLNVVDIAGLVKGAAEGQGLGNSFLSHINACDGIF HLCRAFDDDDVTHVEGDVNPVRDLEIISEELRLKDIEFLNGHLEKLEKLVVRGNDKKLKP EYDTLLKVKGVMVDEKRHIRFADWSATDIEVLNKYLFLTSKPVIYLINLSEKDYVRKKNK WLIKIKEWVDKNDPGAILIPFSGAFENKLLDMNEAERGKYLEEGKVTSALDKIIVQGYKA LQLQYFFTAGHDEVKAWTIQRGTKAPQAAGKIHTDFEKGFIMAEVMKFDDFKNEGSEAAV KAAGKYRQQGRNYVVEDGDIIFFKFNAGAGLKDAKKK |
 Top
| |