| Protein: 66562243 XP_624256.1 PREDICTED: 40S ribosomal protein S13 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 44.4 | 33.9 | 21.7 | 2.046083 | 1.562212 |
| Brain | |||||
| Crop | 56.7 | 43.3 | 1.3094689 | ||
| Eye | |||||
| Intestine | 59.4 | 40.6 | 1.4630542 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 87.1 | 0.6 | 12.3 | 7.0813007 | 0.04878049 |
| Salivary gland, thoracic | 40.4 | 5.8* | 53.8 | 0.75092936 | 0.10780669 |
| Sternite | |||||
| Tergite | 85.8 | 14.2 | 6.0422535 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 30.3 | 37 | 32.6 | 0.9294478 | 1.1349694 |
| Malpighian tubules | 35.6 | 25.5 | 38.9 | 0.9151671 | 0.655527 |
| Nerve chord | 44.4 | 5.9 | 49.7 | 0.89336014 | 0.11871228 |
| Poison sac | |||||
| Sting | 53.7 | 46.3 | 1.1598272 | ||
| Heart | 13.8 | 49.8 | 36.4 | 0.3791209 | 1.3681319 |
| Hypopharyngeal gland | 4.9 | 95.1 | 0.05152471 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 47.7 | 30.3 | 40.4 | 1.180693 | 0.75 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGRMHAPGKGISQSALPYRRSVPTWLKLTPEDCKELIYKLAKKGHTPSQIGVILRDSHGV AQVRFRTGNKILRIVKSMGLAPDLPEDLYYLIKKAVAIRKHLERNRKDKDSKFRLILVES RIHRLARYYKSKGTLPANWKYESSTASALVA |
 Top
| |