| Protein: 328777893 XP_001122588.2 PREDICTED: LDLR chaperone boca |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | 38.9 | 61.1 | 0.63666123 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 10.4 | 89.6 | 0.11607143 | ||
| Rectum | |||||
| Salivary gland, cerebral | 85 | 15 | 5.6666665 | ||
| Salivary gland, thoracic | 37.8 | 22.9 | 39.3 | 0.96183205 | 0.5826972 |
| Sternite | 25.2 | 45 | 29.8 | 0.84563756 | 1.5100671 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 36 | 64 | 0.5625 | ||
| Malpighian tubules | 51.4 | 48.6 | 1.0576131 | ||
| Nerve chord | 43.9 | 18.2 | 37.9 | 1.1583114 | 0.48021108 |
| Poison sac | |||||
| Sting | |||||
| Heart | 17.1 | 39.1 | 43.8 | 0.39041096 | 0.89269406 |
| Hypopharyngeal gland | 57.9 | 42.1 | 1.375297 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.7 | 36.9 | 47.1 | 0.82165605 | 0.7834395 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRKEIIIYSIFLLIYVNANNNVKLNKKKSWRDKDIRDMTDADLEHLLDQWEENDEPLEPD ELPEHLRPSPKIDISKLDMSNPDNVLKMTKKGKSVMMFVDTNEDISAEKAEMIMRIWQTS LQNNHIIAERYPIDQKRSVFLFHEGSQAVDAKNYFLQQPELSHVTLEGQTYFRDPKKQDE NMAKINKIGNKQNVKKDNDKKKMEL |
 Top
| |