| Protein: 297591983 NP_001172073.1 60S acidic ribosomal protein P1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 47.2* | 26.2 | 26.5 | 1.7811321 | 0.98867923 |
| Scape | 45.8 | 26.3 | 27.9 | 1.641577 | 0.94265234 |
| Brain | 48.4 | 23.6 | 28 | 1.7285714 | 0.8428571 |
| Crop | 29.7 | 27 | 43.3 | 0.68591225 | 0.62355655 |
| Eye | 22 | 36.8 | 41.2 | 0.5339806 | 0.89320385 |
| Intestine | 21.3 | 42.8 | 35.9 | 0.59331477 | 1.1922005 |
| Leg, front | 58.4* | 21.6 | 20 | 2.92 | 1.08 |
| Leg, middle | 51* | 27.7 | 21.3 | 2.3943663 | 1.3004695 |
| Leg, rear | 32.3 | 42.6 | 25.1 | 1.2868526 | 1.6972111 |
| Mandibular gland | 60.8 | 4.7 | 34.5 | 1.7623188 | 0.13623188 |
| Rectum | 14 | 48.8 | 37.2 | 0.37634408 | 1.3118279 |
| Salivary gland, cerebral | 69 | 5.5 | 25.5 | 2.7058823 | 0.21568628 |
| Salivary gland, thoracic | 38.3 | 23.6 | 38.1 | 1.0052494 | 0.61942255 |
| Sternite | 23.2 | 27.7 | 49.1 | 0.4725051 | 0.5641548 |
| Tergite | 20.4 | 62.3 | 17.4 | 1.1724138 | 3.5804598 |
| Ventriculus | 42.4 | 3.9* | 53.6 | 0.7910448 | 0.07276119 |
| Thoracic muscle | 22 | 66.1 | 11.9 | 1.8487395 | 5.5546217 |
| Fat body | 31.1 | 43.4 | 25.5 | 1.2196078 | 1.7019608 |
| Malpighian tubules | 36.1 | 22.1 | 41.8 | 0.8636364 | 0.52870816 |
| Nerve chord | 42.7 | 20.6 | 36.7 | 1.1634878 | 0.5613079 |
| Poison sac | 8.5 | 91.5 | 0.09289618 | ||
| Sting | 50.5 | 49.5 | 1.020202 | ||
| Heart | 22.8 | 45.3 | 31.9 | 0.71473354 | 1.4200627 |
| Hypopharyngeal gland | 13.9 | 86.1 | 0.16144018 | ||
| Galea | 23.3 | 36.5 | 40.2 | 0.579602 | 0.9079602 |
| Glossa | 22.6 | 35 | 42.4 | 0.5330189 | 0.8254717 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.9 | 30.5 | 37.8 | 0.94973546 | 0.8068783 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNKKAELACVYSTLILVDDDVAVTGEKIQTILKAANVDVESYWPGLFAKALEGVNIKELI TNIGSGVGKAPAAAPAAAAPASTESAPAKEEKKKEEPEPESDDDMGFGLFD |
 Top
| |