| Protein: 328781655 XP_003250011.1 PREDICTED: f-actin-capping protein subunit alpha-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 52.7 | 47.3 | 1.114165 | ||
| Scape | 30.2 | 32.2 | 37.6 | 0.8031915 | 0.85638297 |
| Brain | 40.6 | 59.4 | 0.68350166 | ||
| Crop | 30.3 | 69.7 | 0.43472022 | ||
| Eye | |||||
| Intestine | 55.8 | 44.2 | 1.2624434 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 24 | 27.8 | 48.1 | 0.4989605 | 0.5779626 |
| Salivary gland, thoracic | 53.5 | 14.4 | 32.1 | 1.6666666 | 0.44859812 |
| Sternite | 14.5 | 32.2 | 53.3 | 0.27204502 | 0.6041276 |
| Tergite | 59.4 | 40.6 | 1.4630542 | ||
| Ventriculus | 55.8 | 44.2 | 1.2624434 | ||
| Thoracic muscle | |||||
| Fat body | 77.7 | 22.3 | 3.484305 | ||
| Malpighian tubules | 28.8 | 28.9 | 42.2 | 0.6824645 | 0.6848341 |
| Nerve chord | 42.6 | 22.4 | 35 | 1.2171428 | 0.64 |
| Poison sac | |||||
| Sting | 57 | 43 | 1.3255814 | ||
| Heart | 27.1 | 37 | 35.9 | 0.75487465 | 1.0306407 |
| Hypopharyngeal gland | 37.9 | 62.1 | 0.61030596 | ||
| Galea | 34.3 | 38.2 | 27.5 | 1.2472727 | 1.3890909 |
| Glossa | 62.3 | 37.7 | 1.65252 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.1 | 38.4 | 43.5 | 0.92183906 | 0.8827586 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAADGDVIPDQEKVRIVSDFILHSPPGEFNEVFNDVRVLLNNDNLLKEGASGAFAQYNKD QLTPVKIEGSEYPALITEHNDLGGQRFYDARSKQSFKYDHLRKEAQDYEPYEPDSVAEPW RSALQDEITTYTQSHYRHGACSVFGKSQGGNITLTACIEDHQFQPKNFWNGRWRSVWTVS FSPSSGNAELRGSLKVQVHYYEDGNVQLVSSKEVKESLPISSEKQTAKELIRLVEESEND YQTAISENYQTMSDTTFKALRRQLPVMRTKIDWNKIVSYSIGKELKSQ |
 Top
| |