| Protein: 110760320 XP_625042.2 PREDICTED: pyridoxal kinase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 36.5 | 30.4 | 33 | 1.1060606 | 0.92121214 |
| Scape | 24.8 | 42.6 | 32.7 | 0.7584098 | 1.3027523 |
| Brain | 59.7 | 40.3 | 1.4813895 | ||
| Crop | 41.8 | 14.3 | 43.9 | 0.952164 | 0.3257403 |
| Eye | |||||
| Intestine | 28.1 | 37.7 | 34.2 | 0.82163745 | 1.1023391 |
| Leg, front | 23.6 | 45.4 | 31 | 0.7612903 | 1.4645162 |
| Leg, middle | 30.1 | 38.8 | 31.1 | 0.9678457 | 1.2475884 |
| Leg, rear | 39.9 | 30.1 | 30 | 1.33 | 1.0033333 |
| Mandibular gland | 3.8 | 78.3 | 17.8 | 0.21348314 | 4.398876 |
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 67.1 | 5.8* | 27.1 | 2.4760149 | 0.21402214 |
| Sternite | 78 | 22 | 3.5454545 | ||
| Tergite | |||||
| Ventriculus | 28.9 | 28 | 43.1 | 0.67053366 | 0.64965194 |
| Thoracic muscle | |||||
| Fat body | 28.1 | 27.5 | 44.4 | 0.6328829 | 0.6193694 |
| Malpighian tubules | 27.3 | 40.3 | 32.4 | 0.8425926 | 1.2438271 |
| Nerve chord | 22.4 | 65.5* | 12.1 | 1.8512397 | 5.4132233 |
| Poison sac | |||||
| Sting | 15.3 | 84.7 | 0.18063754 | ||
| Heart | 12.5 | 48.2 | 39.3 | 0.31806615 | 1.2264631 |
| Hypopharyngeal gland | 70.4 | 29.6 | 2.3783784 | ||
| Galea | 82.9* | 17.1 | 4.8479533 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.6 | 44.2 | 34 | 0.87058824 | 1.3 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSETPRILSIQSHVVSGYVGNKSAIFPLHLLGFEADAINSVQLSNHTGYNIFRGQVLNDK DLGDLIEGLAENNLINYTHLLTGYVGSASFLRKIAEVVRMLKRKNPKLIYVCDPVMGDNG KLYVPETLEEIYRKEIISLADIIVPNQFELELISNIKINTMSDLENAIKKVHKMGPQTVA ISSTEINNKLTTIISTNKDNKLIKIDVPKIPSTFTGSGDLFAALFLAHTYLQDDMKIAIE KTVNSLYNILLKTYEYSQACQNKEYEPVRKIELRLIQNKNCIENPEINFFAEPLIL |
 Top
| |