| Protein: 66524051 XP_397043.2 PREDICTED: adenine phosphoribosyltransferase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 47.8 | 52.2 | 0.91570884 | ||
| Scape | 43.3 | 56.7 | 0.7636684 | ||
| Brain | |||||
| Crop | 48.3 | 51.7 | 0.934236 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 30.4 | 38.1 | 31.6 | 0.96202534 | 1.2056962 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 19.6 | 33.4 | 47.1 | 0.41613588 | 0.7091295 |
| Malpighian tubules | 23.9 | 52.9 | 23.2 | 1.0301725 | 2.2801723 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 46.7 | 53.3 | 0.8761726 | ||
| Heart | 9.9 | 56.9 | 33.3 | 0.2972973 | 1.7087088 |
| Hypopharyngeal gland | 76.3 | 23.7 | 3.2194092 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.1 | 50.3 | 41.4 | 0.70289856 | 1.2149758 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNKNEKIQLLRDSITTFPDFPKPGVMYRDIFGIFRNIAAVRAMKDLIVEHILFLEVDFIV GLDSRGFLFGPIICMELGKPFLPIRKKGKLPGKVFNRTFNLEYGEDTFEIQTEQIKQGSR VLIVDDLLATGGTMEAAIELVKAVGGEVIECLTIIELIGLKGREKLNVPVHSFIQYDS |
 Top
| |