| Protein: 328792910 XP_001122345.2 PREDICTED: transcription factor BTF3 homolog 4-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 49.2 | 30.5 | 20.3 | 2.4236453 | 1.5024631 |
| Scape | 44.1 | 25.8 | 30 | 1.47 | 0.86 |
| Brain | 36.5 | 63.5 | 0.5748032 | ||
| Crop | 29.4 | 30.2 | 40.4 | 0.72772276 | 0.74752474 |
| Eye | |||||
| Intestine | 28.9 | 42.7 | 28.4 | 1.0176057 | 1.5035211 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 7.8 | 92.2 | 0.0845987 | ||
| Rectum | |||||
| Salivary gland, cerebral | 83.5 | 16.5 | 5.060606 | ||
| Salivary gland, thoracic | 49 | 12.4 | 38.6 | 1.26943 | 0.32124352 |
| Sternite | 19.6 | 27.8 | 52.6 | 0.37262356 | 0.5285171 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 48.5 | 26.6 | 24.8 | 1.9556452 | 1.0725807 |
| Malpighian tubules | 27.9 | 36.2 | 35.9 | 0.7771588 | 1.0083566 |
| Nerve chord | 49.6 | 21.7 | 28.7 | 1.728223 | 0.75609756 |
| Poison sac | |||||
| Sting | 55.6 | 44.4 | 1.2522522 | ||
| Heart | 39.5 | 27.1 | 33.4 | 1.1826347 | 0.8113772 |
| Hypopharyngeal gland | 11.4 | 88.6 | 0.12866817 | ||
| Galea | 62.8 | 37.2 | 1.6881721 | ||
| Glossa | 24 | 35.3 | 40.7 | 0.5896806 | 0.86732185 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.6 | 32.2 | 42.1 | 0.91686463 | 0.7648456 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNPEKLKKLQAQVRIGGKGTPRRKKKVVHATAATDDKKLQSCLKKLSVNTIPGIEEVNMI KDDGTVIHFNNPKAQASLSANTFAITGHGENKQITDMLPGIISQLGPEGVTQLKRLASTV SGSTVGKSTLEEDDEVPDLVENFDEASKEEVMNQPK |
 Top
| |