| Protein: 66545506 XP_392689.2 PREDICTED: calreticulin isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 50.1* | 26.6 | 23.3 | 2.1502147 | 1.1416309 |
| Scape | 37.6 | 39.5 | 23 | 1.6347826 | 1.7173913 |
| Brain | 31 | 33.5 | 35.5 | 0.87323946 | 0.943662 |
| Crop | 21.5 | 36.8 | 41.7 | 0.5155875 | 0.88249403 |
| Eye | 32.1 | 42.6 | 25.3 | 1.2687747 | 1.6837945 |
| Intestine | 17.1 | 52.6 | 30.3 | 0.56435645 | 1.7359736 |
| Leg, front | 37.6 | 39.8 | 22.6 | 1.6637168 | 1.7610619 |
| Leg, middle | 39.3 | 35.2 | 25.5 | 1.5411764 | 1.3803922 |
| Leg, rear | 33 | 46 | 21 | 1.5714285 | 2.1904762 |
| Mandibular gland | 22.3 | 77.7 | 0.28700128 | ||
| Rectum | 18.4 | 42.7 | 38.9 | 0.4730077 | 1.0976864 |
| Salivary gland, cerebral | 61.5 | 19.5 | 18.9 | 3.2539682 | 1.031746 |
| Salivary gland, thoracic | 57 | 12.5 | 30.5 | 1.8688525 | 0.40983605 |
| Sternite | 16.3 | 44.6 | 39.1 | 0.4168798 | 1.1406649 |
| Tergite | 9.6 | 69.1 | 21.3 | 0.45070422 | 3.2441316 |
| Ventriculus | 28.5 | 52.9 | 18.6 | 1.532258 | 2.844086 |
| Thoracic muscle | 55.8 | 44.2 | 1.2624434 | ||
| Fat body | 62.2 | 19.9 | 17.9 | 3.4748604 | 1.1117319 |
| Malpighian tubules | 37.9 | 26.7 | 35.4 | 1.0706215 | 0.7542373 |
| Nerve chord | 43.8 | 26.9 | 29.3 | 1.4948806 | 0.91808873 |
| Poison sac | 52.9 | 47.1 | 1.1231422 | ||
| Sting | 51.3 | 48.7 | 1.0533881 | ||
| Heart | 23.8 | 47.3 | 28.9 | 0.8235294 | 1.6366782 |
| Hypopharyngeal gland | 25.1 | 74.9 | 0.3351135 | ||
| Galea | 17.2 | 38.7 | 44.1 | 0.39002267 | 0.877551 |
| Glossa | 20.6 | 31.6 | 47.7 | 0.43186584 | 0.6624738 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.7 | 38.1 | 35.1 | 0.96011394 | 1.0854701 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRSFCSFLLLLAITIATAEIYFEEKFLDDSWEKNWVYSEHPGKEFGKFILGHGKFWNDPE NDKGIQTSQDARFYALSRKFKPFSNKDKTLVIQFTVKHEQNIDCGGGYVKIFDCSLDQKD MHGDSPYQIMFGPDICGPGTKKVHVIFSYKGKNLLINKDIRCKDDIYTHLYTLIVKPDNT YKVLIDNEEVESGELEADWDFLPPKKIKDPSQSKPEDWDDKPTIPDPDDQKPEDWDKPEH IPDPEATKPEDWDDEMDGEWEAPMIDNPEYKGEWKPKQIDNPNYKGPWIHPEIDNPEYTP DPELYKRDEICAIGFDLWQVRSGTIFDNVLITDDPEVARKFGEEVWKPTLEGEKKMKETQ DEEERKQRQKESKENEDNKDDDDDEDADEEENNVPDTEEHDEL |
 Top
| |