| Protein: 110759433 XP_395300.3 PREDICTED: la protein homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 15.3* | 84.7 | 0.18063754 | ||
| Scape | 44.6 | 55.4 | 0.8050541 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 15.2 | 49.6 | 35.2 | 0.4318182 | 1.4090909 |
| Leg, front | |||||
| Leg, middle | 67.9 | 32.1 | 2.115265 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 47.2 | 52.8 | 0.8939394 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 26.6 | 31.6 | 41.8 | 0.6363636 | 0.75598085 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 64.7 | 1.3* | 33.9 | 1.9085546 | 0.038348082 |
| Thoracic muscle | |||||
| Fat body | 33.5 | 36.1 | 30.4 | 1.1019737 | 1.1875 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 5.4 | 40.8 | 53.8 | 0.10037175 | 0.7583643 |
| Hypopharyngeal gland | 23 | 77 | 0.2987013 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.1 | 35.7 | 49.7 | 0.58551306 | 0.7183099 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MENGQEENKAETVISDAVDNEVKNEKPVSDENAIKQTSDEPSSELLEKIKNQIEFYFGDV NMQRDKFLIEQTKLDDGWVPMTVMLNFKMLASMSQEPDVILKAIELSKLMEISEDKKKIR RSPKCPLPIYNEEYRKAQEARTAYVKGFPLQDTNIEKLKTFFSAYEPFENIVMRKYQDKG KKLQFKGSIFVQFKTLEDAKAFMARESIKYGDTELIRKWSADYSAEKAKETEDRRQKRSE MKAKKSESMKDKEDDESGEEDENEKDISLPKGCVIHFIDVPEKCTREDIKERLGELDANI AFVDFKIGDKEGWVRLQEENTAKTIIDKMTDNQILIQDKTVTCRVLEGEEEEKYLTKAKT QIVNTRQKYNKGKKGKKGRNTRGQRKRRNSDNNDLVPNKKAAIE |
 Top
| |