| Protein: 66552230 XP_393559.2 PREDICTED: 26S proteasome non-ATPase regulatory subunit 14 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 36.1 | 63.9 | 0.5649452 | ||
| Scape | 36.7 | 24.4 | 38.9 | 0.9434447 | 0.62724936 |
| Brain | |||||
| Crop | 45.2 | 54.8 | 0.82481754 | ||
| Eye | |||||
| Intestine | 30.5 | 32.8 | 36.7 | 0.8310627 | 0.89373296 |
| Leg, front | 40.6 | 59.4 | 0.68350166 | ||
| Leg, middle | 44.5 | 55.5 | 0.8018018 | ||
| Leg, rear | 49 | 24.2 | 26.7 | 1.835206 | 0.90636706 |
| Mandibular gland | 15.3 | 84.7 | 0.18063754 | ||
| Rectum | |||||
| Salivary gland, cerebral | 52.3 | 47.7 | 1.096436 | ||
| Salivary gland, thoracic | 30.7 | 30.2 | 39.1 | 0.78516626 | 0.7723785 |
| Sternite | 46.9 | 53.1 | 0.88323915 | ||
| Tergite | 66.3 | 33.7 | 1.9673591 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 30.3 | 35.7 | 34 | 0.89117646 | 1.05 |
| Malpighian tubules | 31.5 | 24.7 | 43.8 | 0.7191781 | 0.56392694 |
| Nerve chord | 30.4 | 19.4 | 50.2 | 0.6055777 | 0.3864542 |
| Poison sac | |||||
| Sting | 53.5 | 46.5 | 1.1505376 | ||
| Heart | 25.2 | 34.6 | 40.2 | 0.6268657 | 0.8606965 |
| Hypopharyngeal gland | 59.1 | 40.9 | 1.4449878 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.6 | 35 | 47.2 | 0.7966102 | 0.7415254 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDRLLRLGGAMPGLSQGPPPSDAPVVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLG EFVDDYTVRVIDVFAMPQTGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFG CWLSGVDINTQQSFEALSERAVAVVIDPIQSVKGKVVIDAFRLITPNTMVLGQEPRQTTS NLGHLQKPSVQALIHGLNRHYYSISINYRKNELEQKMLLNLHKKTWMDGLTLAEYSEHSK LNENIVSEMLELAKNYNKALEDEEKMTPEQLAIKNVGKQDPKRHLEEKVDTLMSTNIVQC LGAMLDSVVFK |
 Top
| |