| Protein: 328780126 XP_392468.2 PREDICTED: charged multivesicular body protein 5-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 53.8 | 46.2 | 1.1645021 | ||
| Scape | 24.3 | 38.9 | 36.7 | 0.66212535 | 1.0599455 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 47.3 | 1.8 | 50.9 | 0.92927307 | 0.035363458 |
| Salivary gland, thoracic | 55.6 | 8.4 | 36 | 1.5444444 | 0.23333333 |
| Sternite | 56.2 | 43.8 | 1.283105 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 36.5 | 27.9 | 35.6 | 1.025281 | 0.78370786 |
| Malpighian tubules | 38.3 | 34.8 | 27 | 1.4185185 | 1.2888889 |
| Nerve chord | 32.1 | 28.2 | 39.7 | 0.80856425 | 0.71032745 |
| Poison sac | |||||
| Sting | |||||
| Heart | 40.8 | 21.7 | 37.5 | 1.088 | 0.5786667 |
| Hypopharyngeal gland | 51.9 | 48.1 | 1.079002 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.4 | 29.7 | 40.2 | 1.0298507 | 0.73880595 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSYVTIDGVTGLHESFSLTFRANESNDRKTEEEKRKKRLHFALLNFFFNKMNRLFGRPKP KEPSPSITDCIAGVDSRADSAEKKIAKLDAELKKYKDQMAKMREGPAKNSVKAKALRILK QRKMYEAQVDNLRQQAFNMEQANYATQTLKDTQTTVIAMKEGVKQMQKEFKHINIDQIED LQDDLADMLEQADEVQEAMGRSYGMPDIDEDELAAELEALGDDLAIDEDTSYLDDAIKAP SAPDKEPGTSSVRNKDGVLVDEFGLPQIPAS |
 Top
| |