| Protein: 66549214 XP_624561.1 PREDICTED: cob(I)yrinic acid ac-diamide adenosyltransferase mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.9 | 24.6 | 39.6 | 0.90656567 | 0.6212121 |
| Scape | 33.1 | 28.3 | 38.6 | 0.85751295 | 0.7331606 |
| Brain | 50.2 | 49.8 | 1.0080321 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 35.6 | 31.1 | 33.3 | 1.069069 | 0.9339339 |
| Leg, front | 24.2 | 39.9 | 35.9 | 0.67409474 | 1.1114206 |
| Leg, middle | 23.1 | 38.4 | 38.5 | 0.6 | 0.9974026 |
| Leg, rear | 54.1 | 45.9 | 1.1786492 | ||
| Mandibular gland | 4.4 | 95.6 | 0.046025105 | ||
| Rectum | |||||
| Salivary gland, cerebral | 65.4 | 34.6 | 1.8901734 | ||
| Salivary gland, thoracic | 40.1 | 23.1 | 36.8 | 1.0896739 | 0.6277174 |
| Sternite | 67.9 | 32.1 | 2.115265 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 82.6 | 17.4 | 4.7471266 | ||
| Fat body | 29.8 | 48.5 | 21.7 | 1.373272 | 2.235023 |
| Malpighian tubules | 27.7 | 55 | 17.3 | 1.6011561 | 3.1791906 |
| Nerve chord | 18 | 39.2 | 42.7 | 0.42154565 | 0.91803277 |
| Poison sac | |||||
| Sting | |||||
| Heart | 29.3 | 24.4 | 46.3 | 0.63282937 | 0.52699786 |
| Hypopharyngeal gland | 79.8 | 20.2 | 3.950495 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.4 | 45.2 | 38 | 0.85263157 | 1.1894736 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEVVRSIWKNPVLLYKTGLRASFRNSSSSASKVTKKEDVSIQDNDLQLSNINADINTQND VTFNALVSTEELLAQIGLAREFATDSKVEHPYVDKLKRVQMILFDLSHAILKPMPGKSKA FESKHINDLEEWIAEYANQLPPQETYIIPGGGKACSTLHSAKAVCKRVERNVAFLVQDGL LNKEAQIYLNKLQNFLLTTSRIAAKCDQRTENIYIPRVEVEKNEEK |
 Top
| |