| Protein: 66552169 XP_625152.1 PREDICTED: 60S ribosomal protein L28 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 48.9 | 51.1 | 0.95694715 | ||
| Scape | 47.4 | 19.9 | 32.7 | 1.4495413 | 0.6085627 |
| Brain | |||||
| Crop | 25.1 | 36.9 | 38 | 0.66052634 | 0.97105265 |
| Eye | 34.4 | 65.6 | 0.5243902 | ||
| Intestine | 55.4 | 44.6 | 1.2421525 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 76.4 | 23.6 | 3.2372882 | ||
| Salivary gland, thoracic | 38.2 | 14 | 47.8 | 0.79916316 | 0.29288703 |
| Sternite | 29.7 | 35.6 | 34.7 | 0.8559078 | 1.0259366 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 30 | 33.5 | 36.5 | 0.82191783 | 0.91780823 |
| Malpighian tubules | 34.2 | 27 | 38.8 | 0.8814433 | 0.6958763 |
| Nerve chord | 59.3 | 40.7 | 1.4570024 | ||
| Poison sac | |||||
| Sting | 53.3 | 46.7 | 1.1413276 | ||
| Heart | 6.4 | 53.5 | 40.1 | 0.159601 | 1.3341646 |
| Hypopharyngeal gland | 5.4 | 94.6 | 0.057082452 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.5 | 34.8 | 45.4 | 0.84801763 | 0.76651984 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSHLNWMIIRNNNAFLLKKRNINKPFSTESNNLTNLSSYRYSGLIHRKSVGIVDTSDKK GFTIVYKKAKAMNKPAKATVRCTMKAGARRSLYKLKRLLTKNKYRIDLTKAALRRASAVL RSQKPLPAKKTRTTKKAD |
 Top
| |