| Protein: 328779568 XP_393451.4 PREDICTED: heterogeneous nuclear ribonucleoprotein 27C-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 46.5 | 53.5 | 0.86915886 | ||
| Scape | 30.3 | 36.4 | 33.3 | 0.9099099 | 1.093093 |
| Brain | |||||
| Crop | 44.1 | 55.9 | 0.7889088 | ||
| Eye | |||||
| Intestine | 60.5 | 39.5 | 1.5316455 | ||
| Leg, front | 63.7 | 36.3 | 1.754821 | ||
| Leg, middle | 71.6* | 28.4 | 2.5211267 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 86.5 | 13.5 | 6.4074073 | ||
| Salivary gland, thoracic | 30.1 | 30.5 | 39.5 | 0.7620253 | 0.7721519 |
| Sternite | 76.4 | 23.6 | 3.2372882 | ||
| Tergite | 77.1 | 22.9 | 3.3668122 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 41.6 | 35.6 | 22.8 | 1.8245614 | 1.5614035 |
| Malpighian tubules | 34.7 | 30.2 | 35.2 | 0.98579544 | 0.85795456 |
| Nerve chord | 31 | 27.8 | 41.2 | 0.75242716 | 0.6747573 |
| Poison sac | |||||
| Sting | 62.2 | 37.8 | 1.6455027 | ||
| Heart | 25.7 | 42.5 | 31.8 | 0.8081761 | 1.336478 |
| Hypopharyngeal gland | 55.2 | 44.8 | 1.2321428 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 47.5 | 47.1 | 35 | 1.3571428 | 1.3457143 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRVKTEMDDDEKGKLFVGGLSWETTQENLQRYFGRYGEVIDCVVMKNSESGRSRGFGFVT FSDPANVPLVLQNGPHQLDGRTIDPKPCNPRTQQKPKRSGGFPKVFLGGLPSNVTETDLR SFFTRFGKVMEVVIMYDQEKKKSRGFGFLSFEDEDAVDRCVAEHFVNLNGKQVEIKRAEP RDSSSKMNDSHQGQWGPPQQGGPPMGMAGNMGPMGGPNGQMSGPMMGGPMGPPGNMMQQY QGWGTSPQTGGYAAGYTQYNSQGWGAPPGPPQQQQIPPPPHHQWGSSYNVQPAAATQGYG SYGGPAAAASGGYGPTAGTGGAAGGGPGGSWNSWNMPQNGPPPGTQPPPQPPQPNSSQPN SNSNPSGPQGDMYSRQTTGSGAPGSSSSSAKTPDYTGYSAYGNYADTSYPQRSYQGGESN QGSLFPRRPVHFTDWMTRGLWT |
 Top
| |