| Protein: 328791276 XP_623397.2 PREDICTED: casein kinase II subunit alpha isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 34.2 | 65.8 | 0.51975685 | ||
| Brain | 29.3 | 70.7 | 0.41442716 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 65.7 | 10.9 | 23.5 | 2.7957447 | 0.4638298 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 82.4 | 17.6 | 4.681818 | ||
| Malpighian tubules | 29.6 | 42.9 | 27.5 | 1.0763637 | 1.56 |
| Nerve chord | 40.3 | 24 | 35.7 | 1.1288515 | 0.6722689 |
| Poison sac | |||||
| Sting | |||||
| Heart | 33.6 | 34.7 | 31.6 | 1.0632912 | 1.0981013 |
| Hypopharyngeal gland | 33.9 | 66.1 | 0.5128593 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 50.3 | 30 | 42.3 | 1.1891253 | 0.7092199 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MALPSRARVYTDVNSHKSRDYWDYESYVVDWGQQDDYQLVRKLGRGKYSEVFEAINITNN EKCVVKILKPVKKKKIKREIKILENLKGGTNIITLQAVVKDPVSRTPALIFEHVNNTDFK QLYQTLTDYDIRYYLYELLKALDYCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEFY HPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQL VRIAKVLGTEELFEYLEKYHIELDPRFNDILGRHSRKRWERFMHSENQHLVSHESLDFLD KLLRYDHYERLTAREAMEHPYFYPIVKDQGRLNMVSSSPTPITGSLPVGIDTSREGLNPI PKRDCEQRTGSWNKPTEKYGGTSWKWDSENDEVFITSITSLTYSFQLLIIYARKVESSIP PKFANLRRRKIYYVMVDHTSLHKWQLYFDVVYKILHFRHSLIFTVGIT |
 Top
| |