![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66503969 XP_623933.1 PREDICTED: endoplasmic reticulum oxidoreductin-1-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 4.9* | 95.1 | 0.05152471 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 36.5 | 13.7 | 49.9 | 0.73146296 | 0.2745491 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 40.7 | 59.3 | 0.68634063 | ||
| Nerve chord | |||||
| Poison sac | 2.7 | 97.3 | 0.02774923 | ||
| Sting | |||||
| Heart | 10.3 | 55.3 | 34.4 | 0.2994186 | 1.6075581 |
| Hypopharyngeal gland | 40.3 | 59.7 | 0.67504185 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26.3 | 65.9 | 0.39908952 | ||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKIESSENMFGVLILFTVFSPSIVHSNYFNTNNEKNDQCFCKLKGSIDDCSCNVDTVDYF NNMKIYPRVQSLLVKDYFRFYKVNLNHECPFWTDDSKCAIRYCHVQPCQDEDIPDGLKGD ILRNVHFNENPMDKYKIRAQYDDCLYSAKDHNKELGYLNTTISSENYKDFELWQQYDDAQ DNFCVKESSPGEYVDLLLNPERYTGYKGPSAHRIWKNIYMENCFRPENSPHNFIQSSKIN GMCLEKRVFYRVISGLHASINIHLCSKYLLSSKDNLGIVPGGQWGPNLQEFQKRFSPEET GSEGPNWLKNLYFTYLLELRALAKAAPYLEREEYYTGNKVQDKDTRLAINDILNIIKSFP DHFNESVMFTGGSEAQLLKDQFKQHFRNISRIMDCVGCDKCKLWGKLQIHGLGTALKILF SGKFDRWESTLNNFNRRKFFLERSEIVALINAFGRLSESIFELDKFRQMLR |
|
| |