| Protein: 66504157 XP_624591.1 PREDICTED: UPF0670 protein CG4666-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.5 | 15.1* | 46.4 | 0.82974136 | 0.32543105 |
| Scape | 17 | 46.5 | 36.4 | 0.46703297 | 1.2774725 |
| Brain | |||||
| Crop | 56.7 | 9.1 | 34.2 | 1.6578947 | 0.26608187 |
| Eye | |||||
| Intestine | 25 | 56.4* | 18.6 | 1.344086 | 3.032258 |
| Leg, front | 43.8 | 56.2 | 0.77935946 | ||
| Leg, middle | 40.5 | 59.5 | 0.6806723 | ||
| Leg, rear | 25.9 | 36.1 | 38 | 0.68157893 | 0.95 |
| Mandibular gland | |||||
| Rectum | 43.6 | 56.4 | 0.77304965 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 56.1 | 3.3* | 40.6 | 1.3817734 | 0.08128079 |
| Sternite | 1.9* | 10.7* | 87.4 | 0.02173913 | 0.12242563 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 2.1* | 19.6 | 78.3 | 0.026819924 | 0.25031927 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 4.1* | 95.9 | 0.04275287 | ||
| Heart | 0.4* | 78.1* | 21.4 | 0.018691588 | 3.6495328 |
| Hypopharyngeal gland | 38 | 62 | 0.61290324 | ||
| Galea | 12.9* | 87.1 | 0.14810562 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.3 | 27.5 | 54.6 | 0.53663003 | 0.503663 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MACACLITIALVLYIVFDINYLLRIVFTILTGRLFQKKKKIFDTTTIYGVCTTQDVDLFF KHMNNARYLRELDFARFHYYDRSGIYSAIVEKGGGAVQGASLIRYRRAIPIFTLYKVTTK LIHWDDKNFYLEHEFISLTDGFVRAVVFSKQTVTGSLKVTVPEIIAEIEPNAQRPEMTKD LELWLNSMEESSQRYKKQR |
 Top
| |