| Protein: 328788413 XP_623146.2 PREDICTED: hypothetical protein LOC412543 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.5 | 29.5 | 32 | 1.203125 | 0.921875 |
| Scape | 43.6 | 27.9 | 28.5 | 1.5298246 | 0.97894734 |
| Brain | 47.8 | 52.2 | 0.91570884 | ||
| Crop | 36.6 | 27.7 | 35.7 | 1.0252101 | 0.7759104 |
| Eye | 30.2 | 31.8 | 38 | 0.79473686 | 0.8368421 |
| Intestine | 17.9 | 45.6 | 36.5 | 0.49041095 | 1.249315 |
| Leg, front | 27.4 | 48.1 | 24.5 | 1.1183673 | 1.9632653 |
| Leg, middle | 25.1 | 48 | 26.8 | 0.9365672 | 1.7910448 |
| Leg, rear | 28 | 41.5 | 30.5 | 0.91803277 | 1.3606558 |
| Mandibular gland | 70.4 | 29.6 | 2.3783784 | ||
| Rectum | 44.4 | 15.3 | 40.3 | 1.101737 | 0.37965262 |
| Salivary gland, cerebral | 25.3 | 41.9 | 32.8 | 0.77134144 | 1.277439 |
| Salivary gland, thoracic | 39.7 | 22.3 | 38 | 1.0447369 | 0.5868421 |
| Sternite | 56.3 | 26.3 | 17.4 | 3.2356322 | 1.5114943 |
| Tergite | 57.7 | 17.8 | 24.5 | 2.355102 | 0.7265306 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 71.4 | 13.4 | 15.2 | 4.6973686 | 0.8815789 |
| Malpighian tubules | 79.4* | 14.6 | 6 | 13.233334 | 2.4333334 |
| Nerve chord | 42.1 | 25.6 | 32.3 | 1.3034055 | 0.79256964 |
| Poison sac | |||||
| Sting | 57 | 43 | 1.3255814 | ||
| Heart | 55.6 | 22.3 | 22.1 | 2.5158372 | 1.0090498 |
| Hypopharyngeal gland | 59.5 | 40.5 | 1.4691358 | ||
| Galea | 30.7 | 31.4 | 37.9 | 0.8100264 | 0.82849604 |
| Glossa | 19.4 | 42.6 | 38.1 | 0.5091863 | 1.1181102 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42 | 33.5 | 31.4 | 1.3375796 | 1.066879 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAISLSTEDKLEYNFYPVASGQLQFRIKAPNDAHIALTTGPQEGEPMYEVFIGGWSNSKS VIRKNRTKPDVAEVDTPDILSADEMRGFWIRWNDGVLSIGKEGEPSAFLTYADPEPFGIG YFGVCTGWGASGEWLIEGRGSLSTKNELVYKFHNIRSGSVLIEVRAKSNAHIALTNKKGD SSPMYEIILGGWENTASVIRYDRKQPDKVRVNTPNLLNENETKKFAICWLDGRIMVRVGS LNGSVIMEWQDPTPIGVSYVGVRTGWGATGKWKLQTTLYPSPTAPNYQNVNPTAPPVEGV IDIGKFCWCEASGGIIPPSAVQGGKDIDGNDLYVGRAYHEGALLPGKVKLGDAICYVAWG GEEHLKNDYQVLCDCNPVWVPTTGNNIPHNAIPGGETEDGEPLYVGRVQHEGSLTIGKVQ PSHSVCYIPYGGVEIGYPEYEIMVQRD |
 Top
| |