| Protein: 66515987 XP_395299.2 PREDICTED: translationally-controlled tumor protein homolog isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 46.4 | 26.5 | 27 | 1.7185185 | 0.9814815 |
| Scape | 35.5 | 28 | 36.4 | 0.97527474 | 0.7692308 |
| Brain | 39 | 61 | 0.6393443 | ||
| Crop | 37.3 | 31.6 | 31.1 | 1.1993569 | 1.0160772 |
| Eye | 38.7 | 32.8 | 28.5 | 1.3578948 | 1.1508772 |
| Intestine | 37.9 | 32 | 30 | 1.2633333 | 1.0666667 |
| Leg, front | 56.8* | 20.1 | 23.1 | 2.4588745 | 0.8701299 |
| Leg, middle | 45.7 | 22.1 | 32.2 | 1.4192547 | 0.6863354 |
| Leg, rear | 33.6 | 35.5 | 30.9 | 1.0873786 | 1.1488674 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 54 | 10.2 | 35.9 | 1.5041783 | 0.28412256 |
| Salivary gland, thoracic | 41.7 | 25.8 | 32.5 | 1.2830769 | 0.79384613 |
| Sternite | 56.8 | 25.8 | 17.4 | 3.2643678 | 1.4827586 |
| Tergite | 33.2 | 56.8 | 9.9 | 3.3535354 | 5.737374 |
| Ventriculus | 67.4 | 32.6 | 2.0674846 | ||
| Thoracic muscle | |||||
| Fat body | 58.4 | 17.6 | 23.9 | 2.4435146 | 0.7364017 |
| Malpighian tubules | 29.5 | 32.7 | 37.8 | 0.7804233 | 0.86507934 |
| Nerve chord | 33.6 | 32.7 | 33.7 | 0.99703264 | 0.9703264 |
| Poison sac | |||||
| Sting | 63.2 | 36.8 | 1.7173913 | ||
| Heart | 42 | 36.2 | 21.8 | 1.9266055 | 1.6605505 |
| Hypopharyngeal gland | 8.7 | 91.3 | 0.09529025 | ||
| Galea | 23.4 | 31.4 | 45.2 | 0.5176991 | 0.6946903 |
| Glossa | 25.4 | 21.6 | 53 | 0.47924528 | 0.40754718 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 40.5 | 31.7 | 35.1 | 1.1538461 | 0.9031339 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKIYKDIFTGDEMFSDTYKIKLVDDVLYEVYGKVITRKSGDIEIAGFNPSAEEADEGTDE SVESGVDIVMNHRLQETFAFGDKKSYTLYLKDYMKKLVAKLEEQAPDQVEVFKKNTNKVM KDILSRFNDLQFFTGESMDIDGIVALLEYREIDDESVPVLMLFKHGLEEQKF |
 Top
| |