| Protein: 66532824 XP_624894.1 PREDICTED: ATP-dependent RNA helicase WM6-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 34.6 | 28.5 | 36.9 | 0.9376694 | 0.7723577 |
| Brain | |||||
| Crop | 73.6* | 26.4 | 2.7878788 | ||
| Eye | |||||
| Intestine | 30.4 | 31.5 | 38.2 | 0.79581153 | 0.8246073 |
| Leg, front | 53.5 | 46.5 | 1.1505376 | ||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 36.9 | 63.1 | 0.58478606 | ||
| Salivary gland, thoracic | 29.7 | 25 | 45.3 | 0.65562916 | 0.55187637 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 34.8 | 37.9 | 27.3 | 1.2747253 | 1.3882784 |
| Malpighian tubules | 22.3 | 50.7 | 27 | 0.82592595 | 1.8777778 |
| Nerve chord | 5* | 41.8 | 53.2 | 0.09398496 | 0.78571427 |
| Poison sac | |||||
| Sting | 66.8 | 33.2 | 2.0120482 | ||
| Heart | 15.7 | 45 | 39.3 | 0.3994911 | 1.1450381 |
| Hypopharyngeal gland | 24.3 | 75.7 | 0.32100397 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.3 | 42 | 42.7 | 0.6627635 | 0.9836066 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADNDDLLDYEDEEQTEQLVDGSRDTPAKKEVKGTYVSIHSSGFRDFLLKPEILRAIIDC GFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTAVFVLATLQQLELTENQVYVLVMCHTR ELAFQISKEYERFSKYMPHVKVGVFFGGLPIQKDEEVLKNTCPHIVVGTPGRILALVRNK KLNLKHLKHFILDECDKMLELLDMRRDVQEIFRSTPHGKQVMMFSATLSKEIRPVCKKFM QDPMEVYVDDEAKLTLHGLQQHYVKLKENEKNKKLFELLDVLEFNQVVIFVKSVQRCMAL AQLLTEQNFPAIGIHRGMTQEERLSRYQQFKDFQKRILVATNLFGRGMDIERVNIVFNYD MPEDSDTYLHRVARAGRFGTKGLAITLVSDESDAKILNDVQERFDVNITELPDEIDLASY IEGR |
 Top
| |