| Protein: 328776195 XP_394657.2 PREDICTED: cytochrome b-c1 complex subunit Rieske mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.6 | 30.3 | 29.1 | 1.395189 | 1.0412371 |
| Scape | 45.4 | 25 | 29.5 | 1.5389831 | 0.84745765 |
| Brain | 39 | 28.3 | 32.7 | 1.1926606 | 0.8654434 |
| Crop | 26.5 | 29.9 | 43.6 | 0.60779816 | 0.6857798 |
| Eye | 48.5 | 22.3 | 29.2 | 1.6609589 | 0.76369864 |
| Intestine | 28.8 | 30.2 | 40.9 | 0.70415646 | 0.73838633 |
| Leg, front | 17.1* | 37.2 | 45.8 | 0.37336245 | 0.8122271 |
| Leg, middle | 35.8 | 36.1 | 28 | 1.2785715 | 1.2892857 |
| Leg, rear | 16.3 | 29.9 | 53.8 | 0.302974 | 0.55576205 |
| Mandibular gland | 58.4 | 3.3 | 38.3 | 1.5248042 | 0.08616188 |
| Rectum | 34.9 | 29.1 | 36 | 0.96944445 | 0.80833334 |
| Salivary gland, cerebral | 21.6 | 32.9 | 45.6 | 0.47368422 | 0.7214912 |
| Salivary gland, thoracic | 25.7 | 43.9 | 30.4 | 0.84539473 | 1.4440789 |
| Sternite | 27.2 | 36 | 36.8 | 0.73913044 | 0.9782609 |
| Tergite | 25.1 | 31.6 | 43.3 | 0.5796767 | 0.7297922 |
| Ventriculus | 54.5 | 45.5 | 1.1978022 | ||
| Thoracic muscle | 10.6 | 77.4 | 12 | 0.8833333 | 6.45 |
| Fat body | 34.6 | 50.1 | 15.3 | 2.261438 | 3.27451 |
| Malpighian tubules | 45.3 | 25.5 | 29.2 | 1.5513699 | 0.8732877 |
| Nerve chord | 51 | 16.4 | 32.6 | 1.5644171 | 0.5030675 |
| Poison sac | |||||
| Sting | 44.8 | 55.2 | 0.8115942 | ||
| Heart | 48.8 | 20.2 | 30.9 | 1.579288 | 0.6537217 |
| Hypopharyngeal gland | 72 | 28 | 2.5714285 | ||
| Galea | 54 | 17.2 | 28.8 | 1.875 | 0.5972222 |
| Glossa | 59.7 | 20 | 20.3 | 2.9408867 | 0.9852217 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.1 | 33.8 | 34.4 | 1.0494186 | 0.98255813 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNVVAKSTNFLPLLKSTSVISNGMQPVTGRGALRVSSGIGASLLATQRRLAHTDIQWPDF SDYRHEAVQDPRSKSKENSSSRKSFAYVMTAASGITGAYIAKSAIHDLVATFSASADVLA LAKIEIKLDAIPEGKSAVFKWRGKPIFVRHRSKKEIEKEAAVDIKILRDPQVDLDRVKQP QWLIVLGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPPYDFIDD NTVVIG |
 Top
| |