| Protein: 328782188 XP_003250100.1 PREDICTED: UMP-CMP kinase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 46.8 | 12.2* | 41 | 1.1414634 | 0.297561 |
| Scape | 33.5 | 28.7 | 37.8 | 0.8862434 | 0.7592593 |
| Brain | 49 | 51 | 0.9607843 | ||
| Crop | 27.4 | 72.6 | 0.37741047 | ||
| Eye | |||||
| Intestine | 21 | 42.3 | 36.7 | 0.5722071 | 1.1525886 |
| Leg, front | 26.9 | 47.7 | 25.4 | 1.0590551 | 1.8779528 |
| Leg, middle | 28.1 | 46.6 | 25.3 | 1.1106719 | 1.8418972 |
| Leg, rear | 57.6 | 27 | 15.5 | 3.716129 | 1.7419355 |
| Mandibular gland | 54.7 | 45.3 | 1.2075055 | ||
| Rectum | |||||
| Salivary gland, cerebral | 67.3 | 19 | 13.6 | 4.9485292 | 1.3970588 |
| Salivary gland, thoracic | 35.4 | 24.3 | 40.3 | 0.8784119 | 0.6029777 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 21.2 | 50.5 | 28.3 | 0.7491166 | 1.7844523 |
| Malpighian tubules | 35.8 | 35.7 | 28.4 | 1.2605634 | 1.2570423 |
| Nerve chord | 31.2 | 40.9 | 27.9 | 1.1182796 | 1.4659498 |
| Poison sac | |||||
| Sting | 57.4 | 42.6 | 1.3474178 | ||
| Heart | 25 | 46.6 | 28.4 | 0.8802817 | 1.6408451 |
| Hypopharyngeal gland | 37.7 | 62.3 | 0.60513645 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.3 | 37.1 | 36.6 | 1.0191257 | 1.0136611 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLKIKLSCFSYNWLSVFYVQGPGAGKGTLCRNINEKYGYVHLSAGDLLREERMNSNSKYG ELIENYIKDGKIVPVAITCSLLDRAMQMTDSPHKRFLIDGFPRNQDNIDGWNEAMSNKCV IKGVLFCQCSKEVCTQRCLKRGAAGSGRSDDNEEVLVKRHETYISNTLPIIEYFEKEGLV YKVNSMQLPEKVFEEAKEILSKIGW |
 Top
| |