![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328787116 XP_392845.4 PREDICTED: mannose-1-phosphate guanyltransferase beta-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.9 | 55.1 | 0.81488204 | ||
| Scape | 49.8 | 27 | 23.3 | 2.137339 | 1.1587983 |
| Brain | 51.4 | 48.6 | 1.0576131 | ||
| Crop | 51.5 | 48.5 | 1.0618557 | ||
| Eye | |||||
| Intestine | 58.2 | 41.8 | 1.3923445 | ||
| Leg, front | 66.4 | 33.6 | 1.9761904 | ||
| Leg, middle | 19.2 | 53.1 | 27.6 | 0.6956522 | 1.923913 |
| Leg, rear | 49.6 | 31 | 19.4 | 2.556701 | 1.5979382 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 48 | 2.8 | 49.2 | 0.9756098 | 0.05691057 |
| Salivary gland, thoracic | 48.8 | 13.7 | 37.5 | 1.3013333 | 0.36533332 |
| Sternite | 74.5 | 25.5 | 2.9215686 | ||
| Tergite | 62.2 | 37.8 | 1.6455027 | ||
| Ventriculus | 34.9 | 33.2 | 31.9 | 1.0940439 | 1.0407523 |
| Thoracic muscle | |||||
| Fat body | 10.3 | 30.7 | 59 | 0.17457627 | 0.520339 |
| Malpighian tubules | 22.6 | 47.1 | 30.3 | 0.7458746 | 1.5544554 |
| Nerve chord | 9.1 | 57.3 | 33.6 | 0.27083334 | 1.7053572 |
| Poison sac | |||||
| Sting | 15.2 | 84.8 | 0.17924528 | ||
| Heart | 9.3 | 32.9 | 57.8 | 0.16089965 | 0.56920415 |
| Hypopharyngeal gland | 27.4 | 72.6 | 0.37741047 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.5 | 40.9 | 43.1 | 0.73085845 | 0.9489559 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MQRKRKKLETMRAVILVGGYGTRLRPLTLSRPKPLVEFANKPMLLHQIEALVETNVTEVI LAVSYRAEEMERDLSEEVKKLGVHLIFSHEPEPLGTAGPLALVHDLLCSGDEPFFVLNSD IICDFPFMQLLEFHKSHGKEGTIIVTKVEEPSKYGVVVYRDDGKIENFIEKPQEFISNKI NAGMYILNPSVLKRIELKPTSIEKEIFPNMARDGELYAMELTGFWMDVGQPKDFLKGMSM YLTSLRQKSPAKLYSGPGVVGNVLIDETAKIGKDCRIGPNVTIGPGVILSDGCCIKRSTI LKAAIIKEHAWLDGCIVGWKSVVGRWVRMEGTTVLGEDVIVKDELYINGGQVLPHKNISS SVPEPQIIM |
|
| |