| Protein: 48105901 XP_393035.1 PREDICTED: ras-like protein 2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 50.9 | 49.1 | 1.0366598 | ||
| Scape | 41.5 | 23.5 | 34.9 | 1.1891117 | 0.6733524 |
| Brain | 22.2 | 77.8 | 0.28534704 | ||
| Crop | 57.1 | 21.3 | 21.6 | 2.6435184 | 0.9861111 |
| Eye | 43 | 30.4 | 26.6 | 1.6165414 | 1.1428572 |
| Intestine | 33.7 | 31 | 35.2 | 0.9573864 | 0.8806818 |
| Leg, front | 29.5 | 33.7 | 36.8 | 0.80163044 | 0.9157609 |
| Leg, middle | 18.7 | 39.9 | 41.4 | 0.45169082 | 0.9637681 |
| Leg, rear | 28.3 | 41.8 | 29.9 | 0.9464883 | 1.3979933 |
| Mandibular gland | 23 | 49.3 | 27.7 | 0.8303249 | 1.7797834 |
| Rectum | 4.8 | 95.2 | 0.05042017 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 39.2 | 28.7 | 32.1 | 1.2211838 | 0.894081 |
| Sternite | 39.3 | 29.4 | 31.3 | 1.255591 | 0.93929714 |
| Tergite | 79.2 | 20.8 | 3.8076923 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 47.3 | 29.7 | 23 | 2.0565217 | 1.2913043 |
| Malpighian tubules | |||||
| Nerve chord | 19.6 | 53.5 | 26.9 | 0.7286245 | 1.9888476 |
| Poison sac | |||||
| Sting | 60.8 | 39.2 | 1.5510204 | ||
| Heart | 24.9 | 41.4 | 33.7 | 0.7388724 | 1.2284867 |
| Hypopharyngeal gland | 65.2 | 34.8 | 1.8735632 | ||
| Galea | 36 | 32.2 | 31.8 | 1.1320754 | 1.0125786 |
| Glossa | 47.2 | 26 | 26.7 | 1.7677903 | 0.9737828 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.7 | 35 | 37 | 1.045946 | 0.9459459 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSKSGDKQSYAQTYKLVVVGAGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCVIDDIP AKLDILDTAGQEEFSAMREQYMRSGEGFLLVFSITDLSSFDEILKFHKQILRVKDREEFP MLMVGNKADLDYHRVIEVEEAQNRARRLKIPYIECSAKLRMNVDQAFHELVRIVRKFQLS ERPPLELNYKKNKKKCCML |
 Top
| |