| Protein: 110755689 XP_395004.3 PREDICTED: alpha-2-macroglobulin receptor-associated protein-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 59.5 | 40.5 | 1.4691358 | ||
| Scape | 35.3 | 33.2 | 31.5 | 1.1206349 | 1.0539683 |
| Brain | |||||
| Crop | 46.9 | 53.1 | 0.88323915 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 83.4 | 16.6 | 5.0240965 | ||
| Salivary gland, thoracic | 32.5 | 27.2 | 40.3 | 0.8064516 | 0.67493796 |
| Sternite | 18 | 36.3 | 45.7 | 0.3938731 | 0.79431075 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 40.7 | 34.5 | 24.8 | 1.641129 | 1.391129 |
| Malpighian tubules | 29.7 | 28.6 | 41.7 | 0.7122302 | 0.68585134 |
| Nerve chord | 47.9 | 24 | 28.1 | 1.7046263 | 0.85409254 |
| Poison sac | |||||
| Sting | 41.1 | 58.9 | 0.6977929 | ||
| Heart | 33.8 | 29.4 | 36.7 | 0.92098093 | 0.80108994 |
| Hypopharyngeal gland | 74.5 | 25.5 | 2.9215686 | ||
| Galea | 52 | 6.3* | 41.7 | 1.2470024 | 0.15107913 |
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.5 | 36.8 | 37.3 | 1.1126006 | 0.98659515 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAFLNSISLSISLCTLLFYTTIAFNKYSIEANKPKYEDPLQFPTSLRELDKPFRMAKLNI LWIKAKNRLTDTKLQSIFSDLKIHDKEEIAYKHFKSDGKDPNGEEEARLRKKLIGIMSTY GLLEHFDDTENPELLKKHKALNDGTNYIARNIFKDKRLDKLWVKAEMAGFTHEELQTLKE EFQHHQDKVDEYMNLLKDVENGDSEIHKNSLYHKPESWNEIEQKEEISNNVPGKKLDYLE KATLLREKHLELRNGYDRLDRLTAKGPNHKEFIEPKVQGLWRVVLESQFSPEERASLKEE LLHYEGRLLKLRHLHTEAALEAARQGKQYDLENSTMEQHIKKHARTIQKLHTDLEAKIMQ RHSEL |
 Top
| |