![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66517228 XP_393656.2 PREDICTED: translocating chain-associated membrane protein 1-like 1-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 60.8 | 39.2 | 1.5510204 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 49.4 | 10.8 | 39.8 | 1.241206 | 0.2713568 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 31.5 | 24.3 | 44.2 | 0.7126697 | 0.54977375 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 83.4* | 16.6 | 5.0240965 | ||
| Hypopharyngeal gland | 2.5 | 97.5 | 0.025641026 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.4 | 47.5 | 0.7663158 | ||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVAIKGRKNSNKNPPIFSHEFIIQNHGDIVSCVAMIFVTGLMIQATSPWAYTFIAIHHNI TSDVEDPTMPMKYTTGWKDACAVFFSFLITIVMHAVFQDYIFDKVSKRLHLSKVKLAKFN ESSQLVLFYILSIIWGIDIIIRENLLLNIISLWKEYPIPLSFSSKLFFIGQLAYWLHCYP ELYFQRVKKEDIPPRIIQATIGFLSILAAYIFNFQQVGILLLVPHYIGDVMLHGARLIHF VGKKEKITKMAFLVANSTYIFVRVATLTIAMLVFLYGLSQMESVFDYAVGNFNIPIIRFT ALSYIVIFQIYLSYIFISKQLKRARENVVPVQTTVKSKQKSKKKEGKKSMMSEDDDLPEV DQATKKNLRSRSSAKVK |
|
| |