| Protein: 328793540 XP_392752.3 PREDICTED: scavenger receptor class B member 1 partial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 14.2* | 27.3 | 58.4 | 0.24315068 | 0.46746576 |
| Scape | 49.9 | 5.3* | 44.8 | 1.1138393 | 0.11830357 |
| Brain | |||||
| Crop | 26.3 | 57.9* | 15.9 | 1.654088 | 3.6415095 |
| Eye | |||||
| Intestine | 20.6 | 42.7 | 36.7 | 0.5613079 | 1.1634878 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 15.6 | 84.4 | 0.18483412 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 7.7* | 61.6 | 30.7 | 0.25081432 | 2.0065145 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 86.9* | 13.1 | 6.633588 | ||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | 27 | 73 | 0.369863 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.6 | 37 | 44.6 | 0.7085202 | 0.8295964 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
SREKKLQELSAGSEEDLVVVPNVPMLSATSQSKYAARFLRLAMASIMDILRIKPFVEVSI GQLLWGYEDPLLKLAKDVVPKEQKLPYDQFGLLYGKNGTMPDLFTIYTGQEDIGKYGILD NYNGKRNLGHWTTSECDSIAGTDGSIFPPRITKDTVLKIFDKDLCRALPLVFKEEVITPG RIPGYRFVPAKDAFASPSRLESQQCFCPAGPPCAPEGTFNVSLCQYDSPVLLSFPHFYLG DPTLREAVTGISPPVERDHQFYLDVLPMMGTALRAKARIQINLAVSQVRDIKQVASFPDI VFPIIWFEDGIDELPEEMRNLMKMAVDVPPIARAAVSGTLAAIGAIVLIGALFFLVRAAK RQEKLHLSNPLPSNATASKTGQLNPAFQNPSDSK |
 Top
| |