![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328776539 XP_391950.3 PREDICTED: acetyl-coenzyme A transporter 1-like isoform 1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 49.4 | 50.6 | 0.97628456 | ||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 54.4 | 45.6 | 1.1929824 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 55.8 | 44.2 | 1.2624434 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 50.1 | 10.1 | 39.8 | 1.258794 | 0.25376883 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 24.9 | 32.8 | 42.4 | 0.5872642 | 0.7735849 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 78.9* | 21.1 | 3.7393365 | ||
| Hypopharyngeal gland | 13.6 | 86.4 | 0.1574074 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 45 | 38 | 47.1 | 0.955414 | 0.80679405 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGTRRKMEKDDKLEDGVHESNHVHERSDLRGDETNIAILLFLYLLQGIPLGLCGSIPMLL QNRNVSYRQQAEFSFVQWPFSLKLFWAPIVDSVFSQKFGRRKTWLIPTQYLMGFSMLLLS SHVDQWLGNETSKPNIGMLTIIFFALNVLAATQDIVVDGWALTMLKRCNVGYASTCNSVG QTAGYFIGYVFFIALESAEFCNTYLRSTPSNKGILTLPDVLYFWGWIFVITTTLVALFKH EDSEKMHKDGELNTDVKHAYRLLWNIVKLPSIKIIIVFLLTAKIGFSACDAVTGLKLVEA GIPKEKFALMAVPMIPLQILLPLAISKYTVGPRPMDVYIRAMPYRLAFGLVAAFLVWLTP YVVTGGQVPAYYFILLISLYMIHQIFTSSMFVASMAFFAKISDPAVGGTYMTLLNTLSNL GGNWPATAALWFVDPLTFRQCSTDSSNDCSTISEREFCTNTHNGGVDEKWICYRQDRYQL GKLFFQSRIDNSIESILQLVDTVPVIIKKLYKLNLSMYIDRVCPGLFPARLSSVPIL |
|
| |