| Protein: 66564518 XP_623110.1 PREDICTED: 60S ribosomal protein L12 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 43 | 25.8 | 31.2 | 1.3782052 | 0.8269231 |
| Brain | |||||
| Crop | 17.5 | 37.8 | 44.7 | 0.3914989 | 0.84563756 |
| Eye | 58.5 | 41.5 | 1.4096385 | ||
| Intestine | 7.1* | 50.4 | 42.5 | 0.16705883 | 1.1858823 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 32.2 | 67.8 | 0.47492626 | ||
| Rectum | 65.9 | 34.1 | 1.9325513 | ||
| Salivary gland, cerebral | 78.6 | 3.8 | 17.6 | 4.465909 | 0.2159091 |
| Salivary gland, thoracic | 33 | 27.4 | 39.6 | 0.8333333 | 0.6919192 |
| Sternite | 43.5 | 38.3 | 18.2 | 2.3901098 | 2.1043956 |
| Tergite | 6 | 90.2* | 3.8 | 1.5789474 | 23.736841 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 28.9 | 40.6 | 30.6 | 0.9444444 | 1.3267974 |
| Malpighian tubules | 36.8 | 21 | 42.2 | 0.8720379 | 0.49763033 |
| Nerve chord | 52.3 | 14 | 33.7 | 1.5519288 | 0.41543028 |
| Poison sac | |||||
| Sting | 55.4 | 44.6 | 1.2421525 | ||
| Heart | 21.6 | 41.5 | 36.9 | 0.58536583 | 1.1246612 |
| Hypopharyngeal gland | 20.6 | 79.4 | 0.25944585 | ||
| Galea | 49.2 | 50.8 | 0.96850395 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.6 | 39.4 | 38.8 | 0.8917526 | 1.015464 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MPPKFDPNEIKKVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATSDWKGLKITV QLTIQNRQATISVVPSAASLIIKSLKEPPRDRKRQKNIKHNGNLSFDDIVSIARSMRPRS MSKYLSGTVKEILGTCQSVGCTVEGRPPRDLIEEINGGKLQVPDE |
 Top
| |