| Protein: 328780564 XP_392246.3 PREDICTED: KH domain-containing RNA-binding signal transduction-associated protein 3-like isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 43.3 | 17.2 | 39.6 | 1.0934343 | 0.43434343 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 30.9 | 40.7 | 28.5 | 1.0842105 | 1.4280702 |
| Nerve chord | 64.4 | 5.3 | 30.2 | 2.1324503 | 0.17549668 |
| Poison sac | |||||
| Sting | |||||
| Heart | 18.3 | 35 | 46.8 | 0.39102563 | 0.74786323 |
| Hypopharyngeal gland | 60.1 | 39.9 | 1.5062656 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.2 | 31.7 | 37 | 1.0594594 | 0.85675675 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSDRPSNGEFKYKRDENSDSEAKTSSEKERDEKKYQVDKAGEYVRELLQEKVELDSQKWP NATRLIDQEIQKTQAIGKPVRDPKYVDIYREKPIRVSVKVLVPVREHPKFNFVGKLLGPK GNSMKRLQEETMCKMAVLGRGSMKDRQKEEEYRMSLDPKYAHLSDDLHVEITALAPPAEA YARIAFALAEVRKYLIPDNNDNIRQEQMREMEMNMADDPTSNDDRRPSVRGVPGAGGILR PSARPTMQRSSRAAILPPPSSRGPITRPVSAKSKVFSILDRARVAMDQSYGYETATPPPS NRVGTHHDYDYHTSTSSSSRYGDRHYTSTSGDDMYPSSRYATYEYEDDTVPHSSHNYYET SEYPEESSSRAWKSYKTTTTSGSSSRYRNAPYSRPSK |
 Top
| |