| Protein: 66533867 XP_623325.1 PREDICTED: phosphomannomutase 2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 39.7 | 60.3 | 0.6583748 | ||
| Scape | 19.9 | 48.8 | 31.3 | 0.6357827 | 1.5591054 |
| Brain | |||||
| Crop | 45.4 | 54.6 | 0.83150184 | ||
| Eye | |||||
| Intestine | 56.5 | 43.5 | 1.2988505 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 58.1 | 11.5 | 30.4 | 1.9111842 | 0.37828946 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 20 | 80 | 0.25 | ||
| Thoracic muscle | |||||
| Fat body | 38.1 | 41.3 | 20.6 | 1.8495146 | 2.0048544 |
| Malpighian tubules | 16.1* | 46 | 37.9 | 0.42480212 | 1.2137203 |
| Nerve chord | 62.8 | 37.2 | 1.6881721 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 18.7 | 52 | 29.3 | 0.63822526 | 1.774744 |
| Hypopharyngeal gland | 23.5 | 76.5 | 0.30718955 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.2 | 38.3 | 45.6 | 0.79385966 | 0.8399123 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTKKIICLFDVDGTLTDPRQAIKPSVEKFLLETVRKEFDLAVVGGSDLNKIKEQLGGKNI FEKYKYVFAENGLIAFKNDKQLPSETIQSIIGEEALQDLINFCLKYISELHLPFKRGTFV EFRTGMINISPVGRNCTKKERIQFYEYDLEHQIRQKFIQAIKKEFPDLALTYSIGGQISF DVFPIGWDKTYCLRHIRGYDEIHFFGDKTTEGGNDYEIYESDLTVGHRVTCPEDTINQLN ILMTLMKERREKEQLEFPIQCA |
 Top
| |