| Protein: 328779846 XP_624056.2 PREDICTED: palmitoyl-protein thioesterase 1 partial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 54.1 | 45.9 | 1.1786492 | ||
| Scape | 29.7 | 47 | 23.2 | 1.2801725 | 2.025862 |
| Brain | 59.3 | 40.7 | 1.4570024 | ||
| Crop | 68.6 | 31.4 | 2.1847134 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 10.5 | 31.2 | 58.3 | 0.18010291 | 0.5351629 |
| Rectum | 61.5 | 38.5 | 1.5974026 | ||
| Salivary gland, cerebral | 71.9 | 28.1 | 2.558719 | ||
| Salivary gland, thoracic | 38.3 | 61.7 | 0.62074554 | ||
| Sternite | 15.2 | 20.9 | 63.8 | 0.23824452 | 0.3275862 |
| Tergite | 6.7 | 23.6 | 69.7 | 0.09612626 | 0.33859396 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 16.2 | 17.9 | 65.9 | 0.245827 | 0.27162367 |
| Malpighian tubules | 27 | 36.3 | 36.7 | 0.7356948 | 0.9891008 |
| Nerve chord | 62.6 | 37.4 | 1.6737968 | ||
| Poison sac | 51 | 49 | 1.0408163 | ||
| Sting | 36.6 | 63.4 | 0.5772871 | ||
| Heart | 21.6 | 30.7 | 47.7 | 0.4528302 | 0.6436059 |
| Hypopharyngeal gland | 73.2 | 26.8 | 2.7313433 | ||
| Galea | 39.5 | 60.5 | 0.6528926 | ||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.1 | 44.3 | 47.2 | 0.6377119 | 0.9385593 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
RLGNNEVEDVENSYFGNINVQIQEVCHQLLKDKYLKNGYNAIGFSQGAQFFRALIQRCPN PSVKNFISLGGQHQGIFGLPNCGILKPDICHHLTRIIKYGAYLEFIQKKFIQATYWHDPY HEEEYKEKSTFLADINNEHYINKTYIKNLQKLHTMVLVKFDNDTIVRPAETELFGFYKPG QEKLIQTLEQSDFYHKDRLGLKMLHNAGRIHFLHLPGNHLQFTEDWFVNYIIKPYLI |
 Top
| |