| Protein: 328776512 XP_624399.2 PREDICTED: mitochondrial 2-oxoglutarate/malate carrier protein-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 32.3 | 28.7 | 39 | 0.8282051 | 0.7358974 |
| Brain | |||||
| Crop | 53.1 | 46.9 | 1.1321962 | ||
| Eye | |||||
| Intestine | 41.6 | 58.4 | 0.7123288 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 36.6 | 55.1* | 8.3 | 4.4096384 | 6.638554 |
| Salivary gland, thoracic | 27.8 | 37.2 | 35 | 0.7942857 | 1.0628572 |
| Sternite | 54.4 | 45.6 | 1.1929824 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 17 | 37 | 46 | 0.36956522 | 0.8043478 |
| Malpighian tubules | 28.1 | 45.2 | 26.7 | 1.0524344 | 1.6928838 |
| Nerve chord | 14.3 | 58.8 | 27 | 0.52962965 | 2.1777778 |
| Poison sac | |||||
| Sting | |||||
| Heart | 15.6 | 37 | 47.4 | 0.32911393 | 0.7805907 |
| Hypopharyngeal gland | 82.1 | 17.9 | 4.586592 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.3 | 47.6 | 36.2 | 0.78176796 | 1.3149171 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSNQKTVSTSINFLFGGTAGMAATCVVQPLDLIKNRMQLSGIKISTINIISSILKNEGIL AFYSGLSAGLLRQASYTTTRLGTFEWLSELISKDRQPNFLMKLLIGSSAGCVGAFVGTPA EVALIRMTADGRLPLAERRNYKNAFNALFRIAKEEGFLALWRGTVPTMGRAMVVNAAQLA SYSQSKETLLNTGYFEDNILLHFTSSMISGLVTTIASMPVDIAKTRIQNMKIVDGKPEFK GAIDVIIQVCRNEGVFSLWKGFFPYYARLGPHTVLTFIFLEQIRNFYKTYSV |
 Top
| |