| Protein: 110762605 XP_396879.3 PREDICTED: mannose-1-phosphate guanyltransferase alpha-A-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 28.5 | 71.5 | 0.3986014 | ||
| Scape | 23 | 50.7 | 26.3 | 0.8745247 | 1.9277567 |
| Brain | |||||
| Crop | 59.8 | 40.2 | 1.4875622 | ||
| Eye | |||||
| Intestine | 60.1 | 39.9 | 1.5062656 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 63 | 37 | 1.7027028 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 31.4 | 34.3 | 34.3 | 0.9154519 | 1 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 13.7 | 45.9 | 40.4 | 0.3391089 | 1.1361386 |
| Malpighian tubules | 26.8 | 44.8 | 28.4 | 0.943662 | 1.5774648 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 55.2 | 44.8 | 1.2321428 | ||
| Heart | 8.2 | 44.8 | 47.1 | 0.17409767 | 0.9511677 |
| Hypopharyngeal gland | 39.2 | 60.8 | 0.6447368 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 27.8 | 48.3 | 42.8 | 0.64953274 | 1.1285046 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MILKSVILIGGPSKGTRFRPLSLDIPKPLFPVAGLPVIQHHIEACSKVDNLSEILIIGSY LASDLSQFIEEMINTYKITIRYLQEFTPLGTAGGLYHFRDQIRSGGPTYFFVMNGDVCAD FSLQEIVEYHKEKQALFTIMATEATRQQSLNYGCMVLDKEGKVAHYVEKPSTFVSTLINC GIYVASLDIFQTMADAFYAGQNQENFTQFNGNGKDPAHISLEQDILMRLAGTGRLFALPV LKWWSQVKTAGSAIYANRHYLALYKAKHPNHLASAVNGPCQIIGDIYIHPSASVHPTAVL GPNVSIGPNAIIARGVRIRESIILANAHIQPHSIVLHSIVGKSSYIGEWARIEGTPCDPN PDKPFAKMENLPLFNTNGKLNPSITILGTSVRLAAEKIVLNSIVLPHKELTRNFKNEIIL |
 Top
| |