| Protein: 110755329 XP_001121746.1 PREDICTED: hypothetical protein LOC725960 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.3 | 52.5* | 21.2 | 1.240566 | 2.4764152 |
| Scape | 30.1 | 32.5 | 37.4 | 0.80481285 | 0.868984 |
| Brain | 40.3 | 31.9 | 27.8 | 1.4496403 | 1.147482 |
| Crop | |||||
| Eye | 50.4 | 49.6 | 1.016129 | ||
| Intestine | 18.8 | 52.3 | 28.9 | 0.650519 | 1.8096886 |
| Leg, front | 45.4 | 21.5 | 33.1 | 1.3716012 | 0.6495468 |
| Leg, middle | 54.8* | 20.6 | 24.6 | 2.2276423 | 0.83739835 |
| Leg, rear | 45.6 | 26.6 | 27.8 | 1.6402878 | 0.95683455 |
| Mandibular gland | 13.1 | 86.9 | 0.15074798 | ||
| Rectum | 25.9 | 12.1 | 62 | 0.41774192 | 0.19516128 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 91.3* | 1.3 | 7.4 | 12.337838 | 0.17567568 |
| Sternite | 59.4 | 5.8* | 34.8 | 1.7068965 | 0.16666667 |
| Tergite | 57.8 | 32.8 | 9.4 | 6.1489363 | 3.4893618 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 98.5* | 1.5 | 65.666664 | ||
| Malpighian tubules | 95* | 5 | 19 | ||
| Nerve chord | 35 | 36.5 | 28.5 | 1.2280701 | 1.2807018 |
| Poison sac | |||||
| Sting | 18 | 82 | 0.2195122 | ||
| Heart | 34.4 | 6.2* | 59.5 | 0.5781513 | 0.10420168 |
| Hypopharyngeal gland | |||||
| Galea | 26.6 | 15.4 | 58 | 0.4586207 | 0.26551723 |
| Glossa | 68.5* | 12.2 | 19.3 | 3.5492227 | 0.63212436 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 48.2 | 25.2 | 35.2 | 1.3693181 | 0.71590906 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTKLLVLAMVCLLSQKAVLSMPVAENQEPLQVVPLEKSASKPDAPMNAEAAAAPASQEAA AAAAAPAEPAPAEAKSAAEAEKPSVRSEPSAENPQQGEKALEEKKEEAQQEAKPEEKKEE GGQEKLAEQQQQPQQEQQQPQQEGQQQAQEQKAQEPQGQEEKKEEESLKQAASESHETVV QAVPQEAPVAEVPAEQPVAKAAVAEGKSSEQVDSVEKSAEAGKEEAKEESKEEAKPSVRK EDEASSSGSESEEKAQPAAEEKKAEKPQEEQQEKKAEEKPDRVTRDAEEAAPEEKKPEQP AVQQDQAKAAEENKPAVEGEKAQQPAAVEQPALSSEESSSKSEEKTEAAAAAAAAAAAAA AAPQPEKEAKSAEVGAGSSAANAQQESSEQSAAKPGEASQAKRETAEAQPEAKSEQAEEK KEEGQKQQEAGAKEAKERSDDSSEEKSGEKKESKGSEEEKSSSSEESKQESSKAGDESKP ELLPKPQELKV |
 Top
| |