![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328793854 XP_001121784.2 PREDICTED: rab proteins geranylgeranyltransferase component A 1 partial |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 8.3* | 91.7 | 0.090512544 | ||
| Scape | 39.6 | 19.7 | 40.7 | 0.972973 | 0.48402947 |
| Brain | 34.2 | 65.8 | 0.51975685 | ||
| Crop | 31.3 | 68.7 | 0.45560408 | ||
| Eye | |||||
| Intestine | 60.6 | 39.4 | 1.538071 | ||
| Leg, front | 37.4 | 25.3 | 37.3 | 1.002681 | 0.67828417 |
| Leg, middle | 36.1 | 28.2 | 35.7 | 1.0112045 | 0.789916 |
| Leg, rear | 35.4 | 31.3 | 33.3 | 1.063063 | 0.9399399 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 51.3 | 21.7 | 27.1 | 1.8929889 | 0.80073804 |
| Sternite | |||||
| Tergite | 71.7 | 21.8 | 6.5 | 11.030769 | 3.353846 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 62.6 | 37.4 | 1.6737968 | ||
| Nerve chord | 32.5 | 32.7 | 34.8 | 0.93390805 | 0.9396552 |
| Poison sac | |||||
| Sting | |||||
| Heart | 71.7 | 28.3 | 2.5335689 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 5.7* | 94.3 | 0.060445387 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 47 | 29.5 | 45.8 | 1.0262009 | 0.6441048 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
DEYYGGLWATFNFDGLQKWIEDLKVSKNNTKYVSEVDLESEEKFLETSNEYSTVENIEET WYISNDADLPVVSSKDTQTDSIGDGSSSGDEKADDDKVEKKENVKQWSIDRIRKEYRKFN IDLAPKVKIFFKIYYINITFYIYYYILLLVIHLFTFXXXKLTQVPCSRADVFANKTVSVI EKRMLMQLLTSCMEQGADSPEFDGFRDKTFLEYLNTKNLTPIVQHYVVQAIAMATEKTSC RDGVNRTKHFLNSLGRYGNTPFLWPMYGSGELPQCFCRLCAVFGGVYCLKRQLDGIVIHK NKCKAIISGKQRISLEHLVVGQGHLPPEVVASEGDQRISRGIFITDRSIMQGEKENLTLL YYPPEQPDQEPVTLIELGPSTNACPQGLFMVHMTCKQTTNAKEDLAYVVNKFLKAEPLDP LAIRSSIHSHTQTVSPDKRHLQEGDQDGREESTENPKPQVLWSLYLNLPASDIKLNDSTP SNLHLCSGPDLELDFDFAVNQAKSIFQSMYPDQDFLPRAPDPEEIVLEGEETPGPKFEGD TEAEEKQDVEKPEKED |
|
| |