| Protein: 110772508 XP_001123230.1 PREDICTED: hypothetical protein LOC727522 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 53.7 | 46.3 | 1.1598272 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 85.9* | 1.9* | 12.2 | 7.0409837 | 0.1557377 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 98.7* | 1.3 | 75.92308 | ||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 95.5* | 4.5 | 21.222221 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 83.4 | 16.1 | 5.1801243 | ||
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MYSKENICRGNMMKFLLAILAVLAVTSPLEAFTVPRTGNGALADELQKFVDLIPIKEIIE IVHRYKTEDIEFQQVLQYFQSYEFKTLITEIESIPEWIHILNYAQSAGLDAYYLVNKVNE YLHLPSLKPSSHATKNIGGIRGFLDEVEALIPQDQLKSLYLERVANSAVFADFNRMLGSP VAQSLVNKLCASVNFNNFLTKAKNYGVRLDIIRVDMEERLGLTVPC |
 Top
| |