| Protein: 66547438 XP_624846.1 PREDICTED: uncharacterized protein CG16817-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 55.1 | 17.9 | 27 | 2.0407407 | 0.662963 |
| Brain | 39.4 | 60.6 | 0.650165 | ||
| Crop | 33.2 | 30.8 | 36 | 0.9222222 | 0.85555553 |
| Eye | 47.4 | 52.6 | 0.9011407 | ||
| Intestine | 52.6 | 47.4 | 1.1097046 | ||
| Leg, front | 57.5 | 42.5 | 1.3529412 | ||
| Leg, middle | |||||
| Leg, rear | 84.9* | 15.1 | 5.6225166 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 56.1 | 12 | 31.9 | 1.7586207 | 0.37617555 |
| Salivary gland, thoracic | 50.8 | 17.7 | 31.5 | 1.6126984 | 0.5619048 |
| Sternite | 71.9 | 28.1 | 2.558719 | ||
| Tergite | 70.3 | 29.7 | 2.3670034 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 44.2 | 30.7 | 25.2 | 1.7539682 | 1.218254 |
| Malpighian tubules | 32.2 | 34.7 | 33.1 | 0.9728097 | 1.0483384 |
| Nerve chord | 37.6 | 11.4 | 51 | 0.7372549 | 0.22352941 |
| Poison sac | |||||
| Sting | 59.3 | 40.7 | 1.4570024 | ||
| Heart | 34 | 37.3 | 28.7 | 1.184669 | 1.2996516 |
| Hypopharyngeal gland | 67.3 | 32.7 | 2.058104 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 49.6 | 38.6 | 36.1 | 1.3739612 | 1.0692521 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTQEGQLPPPPVMWAQRKDILFVTICLEDCKDPIINIEPQMIYFKGIGGTEQKMHEVTIN LYEEITPNRTIQNLRGRTLELVLFKKEEGPYWPRLTKEKTKAHWLKSDFNKWKDEDDSDD EGGMEGSSHDLEEMMRQMGGLGGSGDSKPNFDDLDELGDEGEGMDSDDDDLPDLLE |
 Top
| |