![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 110761744 XP_623822.2 PREDICTED: erlin-1-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 4.6 | 95.4 | 0.04821803 | ||
| Brain | 41.6 | 58.4 | 0.7123288 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 39.6 | 60.4 | 0.65562916 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 32.4 | 18.1 | 49.5 | 0.6545454 | 0.36565655 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 9 | 54 | 37 | 0.24324325 | 1.4594594 |
| Hypopharyngeal gland | 44 | 56 | 0.78571427 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 27 | 32.4 | 59.5 | 0.45378152 | 0.54453784 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFDQSIIGICFCVCLAIVFNFSLHRIEEGHVGVYFRGGALLPQVSNPGFHMMIPLLTTYR AVQVTLQTDEVKNVPCGTSGGVMIYFDRIEVVNILDANSVYNMVRNFTADYDQTLIFNKI HHELNQFCSVHTLHEVYIDLFDQIDENLKTALQKDLNDLAPGLSIHAVRVTKPKIPETLR KNYELMEAEKTKLLISIQHQKVVEKDAETDRKKAVIEAEKEAQVAKIQFNQKIMEKESLQ RIATIEDEMHLARQKSHSDAEYYQTKMQAEANRLLLTKEFLELKKYEALAQNTKVYYGQD IPKMFMYGGCSNDDSTNSRIEIQK |
|
| |