| Protein: 328791257 XP_625289.3 PREDICTED: hypothetical protein LOC552459 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 5.9 | 79.8* | 14.2 | 0.41549295 | 5.619718 |
| Scape | 17.8* | 27.3 | 54.9 | 0.32422587 | 0.49726775 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 27.1 | 31.8 | 41.1 | 0.6593674 | 0.77372265 |
| Leg, middle | 20.3 | 42.5 | 37.2 | 0.54569894 | 1.1424731 |
| Leg, rear | 23.9 | 34.1 | 41.9 | 0.5704057 | 0.8138425 |
| Mandibular gland | 10.3 | 89.7 | 0.1148272 | ||
| Rectum | 36.1 | 63.9 | 0.5649452 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 9.9 | 72.6* | 17.5 | 0.5657143 | 4.1485715 |
| Sternite | 21.2 | 30.5 | 48.3 | 0.4389234 | 0.63146996 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 20.3 | 69.3* | 10.4 | 1.9519231 | 6.6634617 |
| Poison sac | |||||
| Sting | 58.1 | 41.9 | 1.3866348 | ||
| Heart | 42.6 | 11.7* | 45.6 | 0.93421054 | 0.25657895 |
| Hypopharyngeal gland | |||||
| Galea | 23.3 | 37.4 | 39.3 | 0.5928753 | 0.95165396 |
| Glossa | 40.2 | 21.1 | 38.7 | 1.0387597 | 0.54521966 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 21.9 | 42.5 | 41.8 | 0.52392346 | 1.0167464 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MWKYRTIGLFALLALLCIQARAADIIVKRHTFDDTLTSHGKQFFSDLAGLGGGLGSGLGG GLGGGFGGGFGGGGAGGYSGAGSGAGGYSGAGASSGAGVGGYGKLGCSGGSCGAGGGAGG RGGAGAGGYGGAGGGGGAGGYGGAGSGGGAGGYGGAGAGGGAGAHGGSAGIIKTAPGGPG GYGGAGGGAGSGGYGGAGAGGGSGGYGGAGAGGGSGGYGGAGGGAGSGGYGGAGAGAGSG GYGGAGAGSGGYGGAGAGGGSGGGRGGAGGYGGAGGYGGAGGGGAGGHGGSGGGSCPGGC KGGYGGASANANAYASANANANANARATASANANAFSSASASANANANAGGGGFGSGFDD FGPGGHGVDLFNRMGSIDEGVSKSGSVDKAKGVYSNSAANIDSTGKGSYKVSAGKIA |
 Top
| |