| Protein: 94158830 NP_001035317.1 odorant binding protein 18 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 25.9 | 51.8 | 22.3 | 1.161435 | 2.32287 |
| Scape | 56.4* | 41.7* | 1.9 | 29.68421 | 21.947369 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 53.4* | 29.5 | 17.1 | 3.122807 | 1.7251462 |
| Leg, middle | 55.9* | 26.6 | 17.5 | 3.1942856 | 1.52 |
| Leg, rear | 34.6 | 39.3 | 26.1 | 1.3256705 | 1.5057471 |
| Mandibular gland | 41.2 | 29.2 | 29.6 | 1.3918918 | 0.9864865 |
| Rectum | |||||
| Salivary gland, cerebral | 52.9 | 47.1 | 1.1231422 | ||
| Salivary gland, thoracic | |||||
| Sternite | 67.4 | 9.6 | 23 | 2.9304347 | 0.4173913 |
| Tergite | 54.8 | 28.2 | 17 | 3.2235293 | 1.6588235 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 88.6* | 11.4 | 7.7719297 | ||
| Poison sac | |||||
| Sting | 38.6 | 61.4 | 0.6286645 | ||
| Heart | 43.2 | 34.8 | 21.9 | 1.9726027 | 1.5890411 |
| Hypopharyngeal gland | |||||
| Galea | 38.5* | 54.6* | 6.9 | 5.57971 | 7.9130435 |
| Glossa | 54.9* | 35.3 | 9.9 | 5.5454545 | 3.5656567 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 48.3 | 39.1 | 22.4 | 2.15625 | 1.7455357 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKTFVIISAICVCVGALTLEEFQIGLRAVVPICRIETSIDQQKEDDFRDGNIDVEDEKVQ LFSECLIKKFNGYDDGGNFNEVVIREIAEIFLDENGVNKLITECSAISDADLAVKSAKLL KCIGKYKTLKEMLSG |
 Top
| |