| Protein: 110766380 XP_001122696.1 PREDICTED: protein takeout-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 22 | 78 | 0.2820513 | ||
| Scape | 2.2* | 59.7 | 38.1 | 0.057742782 | 1.5669291 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 16.1 | 48.5 | 35.5 | 0.45352113 | 1.3661972 |
| Leg, middle | 10.6* | 52.1 | 37.3 | 0.2841823 | 1.3967829 |
| Leg, rear | 3.5* | 55.1 | 41.4 | 0.08454106 | 1.3309178 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 70.7 | 29.3 | 2.4129694 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 50.4 | 49.6 | 1.016129 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 10.9 | 56.1 | 44.1 | 0.24716553 | 1.2721088 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNKITVIGSIVIVTVFATVFARDLPDFIHVCKKNDPNLSKCITDSVNHLRPYLNTGLPEY NIPALEPFLLKELITTTEENVKLKLRNIKVYGASNFTITKLKSNIDTLNFVVDLDFSNLI IKGEYDVDGQLLLLRIRGSGALNGQFNNCKALVKLQMEMTKGKDGQNYLKLADLQTKIFV GSGSSLKLDNLFGGDPVLGDAINVAINSNFDSFLKEITPIIENAISNTFTDISNSILKQF PYEKLFPES |
 Top
| |