![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 254911140 NP_001157186.1 gram-negative bacteria-binding protein 1-2 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 9.7 | 79.5* | 10.8 | 0.8981481 | 7.361111 |
| Scape | 8.6 | 76.7* | 14.7 | 0.585034 | 5.217687 |
| Brain | |||||
| Crop | 53 | 47 | 1.1276596 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 81* | 19 | 4.263158 | ||
| Leg, middle | 74.3 | 25.7 | 2.8910506 | ||
| Leg, rear | |||||
| Mandibular gland | 11.4 | 88.6 | 0.12866817 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | 54 | 46 | 1.173913 | ||
| Ventriculus | |||||
| Thoracic muscle | 53.8 | 46.2 | 1.1645021 | ||
| Fat body | 54.9 | 45.1 | 1.2172949 | ||
| Malpighian tubules | |||||
| Nerve chord | 91.2* | 8.8 | 10.363636 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 2.1 | 63.9 | 34 | 0.061764706 | 1.8794118 |
| Hypopharyngeal gland | |||||
| Galea | 43.6 | 56.4 | 0.77304965 | ||
| Glossa | 27.1 | 20.5 | 52.4 | 0.51717556 | 0.39122137 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 18.8 | 63 | 38.1 | 0.49343833 | 1.6535434 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKILFMTNCFIVIIISLFSIAIQENLAQYVPPTPSVEPLYPVGLRMSIADEAGISLVAYH VKFNDDFYSLEAGTIARDIIKPRNGYWVYEDRSTRLKLGDIIYYWIHVVYNGLGYNLLDQ KHVVNEFYNYDGSPHSNGKISLENKIDTCIASSQTKIFESNSKNQLLNTRICPGQLIFEE NFDSLNTTRWTILERFAGPPSYEFVIYMNNIENVKIKDGILHIEPTLTNEKYGPDFIRTN NLTLEKCTEMIENECKRFAFGSYILPPVISGRLNTKSSFNFQYGRIQIRAKLPRGDWLFP LITLESTDMCTKNSSIYCDIIIVHSNGNSVLMSQDGNDLSGHFLLGGAHATDINSHVPHD NKLNLPKKKSETLWSDEYHVYDLEWKPNQIIVKVDGVEYGQQNVPGLYDIPVYINIGLAV GGHTIFPDNCISNNYVKPWRNVGSKALYHFHLAEKDWIKSWRVSDTGLHVDYIKIWAV |
|
| |