| Protein: 328779928 XP_003249720.1 PREDICTED: cytosol aminopeptidase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 29.1 | 36.5 | 34.3 | 0.8483965 | 1.06414 |
| Scape | 32.8 | 34.1 | 33.1 | 0.9909366 | 1.0302114 |
| Brain | 22.1 | 37.7 | 40.2 | 0.5497512 | 0.93781096 |
| Crop | 32.6 | 37.6 | 29.7 | 1.0976431 | 1.2659932 |
| Eye | 10.8 | 68.8 | 20.4 | 0.5294118 | 3.372549 |
| Intestine | 32.9 | 33.3 | 33.8 | 0.97337276 | 0.9852071 |
| Leg, front | 31.2 | 36.8 | 32 | 0.975 | 1.15 |
| Leg, middle | 42.3 | 30.4 | 27.2 | 1.555147 | 1.117647 |
| Leg, rear | 39.6 | 38.4 | 22 | 1.8 | 1.7454545 |
| Mandibular gland | 29.1 | 70.9 | 0.41043723 | ||
| Rectum | 35.2 | 23.2 | 41.5 | 0.84819275 | 0.55903614 |
| Salivary gland, cerebral | 32.5 | 27.1 | 40.4 | 0.80445546 | 0.6707921 |
| Salivary gland, thoracic | 38.1 | 27.5 | 34.3 | 1.1107872 | 0.8017493 |
| Sternite | 31.6 | 40.4 | 28 | 1.1285714 | 1.4428571 |
| Tergite | 36 | 42.7 | 21.3 | 1.6901408 | 2.004695 |
| Ventriculus | 26.2 | 53 | 20.7 | 1.2657005 | 2.5603864 |
| Thoracic muscle | 8.6 | 76.2 | 15.2 | 0.56578946 | 5.013158 |
| Fat body | 45.3 | 24.1 | 30.6 | 1.4803921 | 0.7875817 |
| Malpighian tubules | 29.1 | 35 | 35.9 | 0.81058496 | 0.97493035 |
| Nerve chord | 18.5 | 45.2 | 36.4 | 0.5082418 | 1.2417582 |
| Poison sac | |||||
| Sting | 51.1 | 48.9 | 1.0449898 | ||
| Heart | 19.3 | 43.6 | 37.1 | 0.52021563 | 1.1752021 |
| Hypopharyngeal gland | 44.8 | 55.2 | 0.8115942 | ||
| Galea | 73.1 | 26.9 | 2.717472 | ||
| Glossa | 22.4 | 57.2 | 20.4 | 1.0980393 | 2.8039215 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.3 | 42.4 | 33.5 | 0.8746269 | 1.2656716 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MALSLIRGKGLQYGNSQLRFLSNISAMKKGLVLGIYEAEDENNISLTPTAINYDELVKGK LRQNIFLAGPKIPKGHARVFWGLDEKDYAGIAVVGLGKKNLGINQLEEIHEGKENIRIAA AAGCRALDAVEIKDIQLEALGDAEAAAEGAALSMWFYQGLKNKEKQKILPKVSLYGQEGE EQWRIGNIKAQAQNWARHLADTPANLMTPTIFSTEVHTILTKLGITVQIHNEEWAEQKKM GSFLSVSHGSCEPPKFIEIHYKNADNSQPVVFIGKGVTFDAGGISLKPSADMDEMRADMS GAACVVAAIRAAAELKLKLNIVGLIPLTENLPSGTATKPGDIVIAMNGKSIIVDNTDAEG RLILADALCYAQEFNPSFILDIATLTGAMRIALGGAATGVFTNNSTLFEKLKNAGTLSGD RVWRFPLWQHFTDEMTKKVKSADVRNVAKIKGVMGPGPDKLPYIPAE |
 Top
| |