| Protein: 328788967 XP_624385.3 PREDICTED: 32-trans-enoyl-CoA isomerase mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 55.9 | 44.1 | 1.2675737 | ||
| Scape | 29.4 | 43.5 | 27.2 | 1.0808823 | 1.5992647 |
| Brain | 58.6 | 41.4 | 1.4154589 | ||
| Crop | 28.2 | 46.7 | 25.2 | 1.1190476 | 1.8531746 |
| Eye | |||||
| Intestine | 1.4* | 52.3 | 46.3 | 0.030237582 | 1.1295897 |
| Leg, front | 37 | 32.1 | 30.9 | 1.1974111 | 1.0388349 |
| Leg, middle | 43.9 | 28.9 | 27.2 | 1.6139706 | 1.0625 |
| Leg, rear | 35.5 | 34.8 | 29.8 | 1.1912751 | 1.1677853 |
| Mandibular gland | 34.5 | 65.5 | 0.52671754 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 28.1 | 21.8 | 50 | 0.562 | 0.436 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 43.6 | 37.9 | 18.5 | 2.3567567 | 2.0486486 |
| Malpighian tubules | 38.6 | 38.3 | 23.1 | 1.6709957 | 1.6580087 |
| Nerve chord | 26.4 | 57.3 | 16.2 | 1.6296296 | 3.5370371 |
| Poison sac | |||||
| Sting | |||||
| Heart | 77.2* | 22.8 | 3.3859649 | ||
| Hypopharyngeal gland | 65.6 | 34.4 | 1.9069767 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.5 | 45.8 | 33.5 | 1 | 1.3671641 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFIVKKIFNKSLKIPLYRTYTVNSKVIEVTKDDTDIVTISMAYPPINCLNKELLNALNTS LINVQKQKCQGVILTSSLSNIFSAGIDIKELYNRTEKQLIEYWTTIQNMWLTLYNLEIPI AAAINGSCPAAGCVLAMSCEYRILVEGKHTIGLNETQLGIFAPEWTKALYIDIIGYRRAE LALLQGTLFHPKEALEIGLVDELALNKANAIERCQNYIKSFKNIPFKGRQKTKMELRKHN SLWLKANANSDLNKFLTFIQSPNVQANLKLYIEALKNKNV |
 Top
| |